SecReT4
Protein ID: 332288436
T4SS name [ID]Tfc [680]
Gene symbol-
Locus tagUMN179_00354
StrainGallibacterium anatis UMN179
Repliconchromosome [GenBank: NC_015460] [Browse all T4SS(s) in this replicon]
Location [Strand]354047..354745 [-]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDF4HBN4
KEGG IDgan:UMN179_00354
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.4e-58, Aligned region: 41..229
Protein Sequence: 232 a.a.     [Download]
>gi|332288436|ref|YP_004419288.1| integrating conjugative element membrane protein [Gallibacterium anatis UMN179]
MAEQQVKEPRRGLLGNLLSLLGRTFGVLVVSLFVSIVIEWIGMIWFWPELGAQHSKQMMLDEVQYFSVHF
TQSILHADPVVLATYVMDTVHQYVFVKSGLLAWLNSVQDPSSPGYALIIYIRGYIEAVIYITMTFIIRLL
ILFFTSPLFILVAVVGFTDGLVRRDLRRFGYGYESSFMYHHAKKAIFPLLIGSWMLYLSLPFSIYPNLLL
IPAAFLVGTAISIASASFKKYL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|332288085|ref|NC_015460.1|:c354745-354047 Gallibacterium anatis UMN179 chromosome, complete genome
ATGGCTGAACAACAGGTAAAAGAACCTAGAAGAGGGTTGTTAGGTAATCTATTATCGTTGCTTGGTAGAA
CCTTTGGTGTGTTAGTCGTGTCATTATTTGTCAGTATTGTGATTGAATGGATCGGTATGATCTGGTTTTG
GCCGGAACTTGGTGCTCAGCATAGTAAACAAATGATGTTGGATGAAGTGCAGTATTTTTCTGTGCATTTT
ACACAAAGTATTCTGCACGCTGATCCGGTAGTGTTAGCAACCTATGTAATGGATACCGTACATCAATATG
TATTTGTGAAAAGTGGATTGTTAGCGTGGTTAAATAGTGTACAAGACCCAAGCAGTCCAGGATATGCATT
AATTATTTATATTCGCGGTTATATTGAAGCGGTTATATATATCACAATGACGTTTATTATTCGGTTACTC
ATCCTGTTTTTTACCTCACCATTGTTTATTTTGGTTGCCGTGGTTGGTTTCACGGATGGGCTTGTACGTC
GGGATTTAAGGCGATTTGGGTACGGTTATGAATCAAGTTTTATGTATCATCACGCGAAAAAAGCGATATT
TCCGCTGTTAATCGGCTCTTGGATGTTATATCTTTCGTTACCGTTTAGTATATATCCAAATTTGTTGCTG
ATTCCAGCAGCATTTTTAGTGGGGACAGCAATTTCTATTGCGTCAGCGAGTTTCAAAAAATATCTTTAA
 Primer design