SecReT4
Protein ID: 332288439
T4SS name [ID]Tfc [680]
Gene symbol-
Locus tagUMN179_00357
StrainGallibacterium anatis UMN179
Repliconchromosome [GenBank: NC_015460] [Browse all T4SS(s) in this replicon]
Location [Strand]357482..358174 [-]
Productputative lytic transglycosylase, catalytic
Component typeTfc4
UniProt IDF4HBN7
KEGG IDgan:UMN179_00357
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 230 a.a.     [Download]
>gi|332288439|ref|YP_004419291.1| putative lytic transglycosylase, catalytic [Gallibacterium anatis UMN179]
MIFRYAVILIGLLGYSVYSAAITHNVQPIPGIFHRVANQYSVPASMLYAIALNETGRRVTNVKQPYPWSI
NVKGRSYFYPSQIKACQALQQFMSRYPLKNIDVGVAQVNLGWNGIKYFRSACEGFDVAKNLNAAAQILRD
CYVERGDWLHASGCYHHPKGGFYAARYMRNIKQHLSILSSTSSVTPDNWTSPPAIAGVSVESDQRHYQWI
LPSQTIQTAFIWVDPNKESQ
 
Nucleotide Sequence: 693 bp     [Download]
>gi|332288085|ref|NC_015460.1|:c358174-357482 Gallibacterium anatis UMN179 chromosome, complete genome
ATGATTTTTAGATATGCAGTAATACTGATTGGTTTATTGGGATATAGTGTCTATAGTGCTGCCATTACGC
ATAATGTGCAGCCTATACCGGGGATTTTCCATCGGGTTGCAAATCAGTATTCTGTGCCTGCATCAATGTT
ATATGCGATTGCATTGAATGAAACTGGTCGCAGAGTAACAAACGTAAAGCAACCCTATCCGTGGTCGATT
AATGTCAAAGGACGTAGTTATTTTTATCCCTCTCAAATTAAAGCCTGCCAAGCATTACAGCAATTTATGT
CTCGTTATCCGTTAAAAAATATTGATGTTGGTGTTGCTCAGGTAAATTTGGGCTGGAACGGTATTAAGTA
TTTTCGGAGTGCTTGCGAGGGCTTTGATGTCGCAAAAAATTTAAATGCGGCTGCACAAATTTTGAGAGAT
TGCTATGTTGAAAGAGGTGATTGGTTACACGCTTCGGGGTGTTATCATCATCCAAAAGGCGGTTTTTATG
CTGCCCGCTATATGCGTAATATCAAACAACACTTATCAATATTATCGTCTACTTCTTCCGTAACGCCAGA
TAACTGGACTTCACCGCCTGCGATTGCAGGTGTGAGTGTTGAAAGCGATCAGCGTCACTATCAATGGATT
TTACCATCACAAACCATACAAACTGCTTTTATTTGGGTTGATCCAAACAAGGAGAGTCAATGA
 Primer design