SecReT4
Protein ID: 333895578
T4SS name [ID]Tfc [748]
Gene symbol-
Locus tagambt_20800
StrainAlteromonas sp. SN2
Repliconchromosome [GenBank: NC_015554] [Browse all T4SS(s) in this replicon]
Location [Strand]4671328..4672656 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDF5Z6Y8
KEGG IDalt:ambt_20800
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 442 a.a.     [Download]
>gi|333895578|ref|YP_004469453.1| hypothetical protein ambt_20800 [Alteromonas sp. SN2]
MRFNRYYFISVIFVVSAQLSFAEPAPNDDSLFYYKIGGGRDIAIPPSLNITTIDLSLNASATALTCSGFD
PMVAIENSLDNLRNGVDNAVNALELAASAAIANLPGYILQKANPGLYDLFQNALLRANEAFSLATKSCER
IQYEISNGTNPYAEWVTVSWGDSWKRSLGVGNANIHDAVDDAEDAHNDGIEWVGGQRRGGQDQPPIRVLT
DVATAGLNILSQRPPETTANLPSSAPLADHFDGPNAVDEWVNNVLGEVEIGICDGCSKGARSGKGLIPYI
EQTTEDILPLLVNLIAGATRPTRDHLNEVEAPGVAITLQVILALRQLPAQERSIVVHKLAQEVAEARVME
EAMIIRRLLLSGRKEGYIAANKIAQKEVQIALDELEGEIQNVIFEKDARNKFVTSTVVELLLRDNAERQS
SLNTPASTPEDPRPLSNGGVEP
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|333891490|ref|NC_015554.1|:c4672656-4671328 Alteromonas sp. SN2 chromosome, complete genome
ATGAGGTTTAATCGATACTATTTTATCTCGGTCATTTTCGTTGTGAGCGCTCAACTATCCTTTGCTGAGC
CAGCACCTAACGATGACAGCCTGTTTTACTACAAAATCGGCGGCGGTCGGGATATTGCCATTCCTCCCAG
CCTGAATATCACAACGATAGATTTGTCATTGAATGCATCTGCTACCGCGTTGACCTGTAGCGGGTTCGAC
CCGATGGTGGCCATCGAGAACTCGCTAGACAATCTGAGAAATGGTGTTGATAACGCCGTGAATGCGCTGG
AACTGGCGGCATCAGCGGCCATAGCGAATCTACCAGGCTACATACTACAAAAAGCTAACCCCGGCCTTTA
TGACCTGTTTCAGAATGCGCTGCTGCGTGCTAACGAAGCCTTCTCGCTAGCGACCAAAAGCTGTGAGCGC
ATTCAGTATGAAATTTCTAACGGCACTAACCCCTATGCCGAATGGGTAACGGTGAGTTGGGGCGATTCTT
GGAAGCGCTCACTGGGTGTCGGTAACGCCAATATTCATGACGCGGTGGATGATGCAGAAGACGCTCATAA
CGATGGCATTGAGTGGGTGGGAGGACAACGGCGAGGCGGGCAAGATCAGCCTCCGATTCGTGTACTTACC
GATGTGGCTACTGCAGGCTTAAATATCCTGTCACAACGGCCGCCGGAAACCACAGCCAATTTACCCAGTT
CAGCGCCATTGGCCGATCACTTCGATGGGCCAAATGCAGTTGATGAATGGGTTAATAATGTACTCGGTGA
GGTGGAAATTGGCATCTGCGATGGCTGCTCTAAGGGCGCTCGCTCCGGCAAGGGGCTGATTCCTTACATT
GAACAAACTACCGAAGATATATTACCGCTGTTGGTAAACCTGATTGCGGGTGCTACACGTCCCACGCGGG
ATCACCTTAATGAGGTAGAAGCTCCTGGTGTCGCTATCACACTGCAAGTGATTCTCGCTCTTCGTCAACT
CCCCGCACAGGAACGGTCGATTGTAGTTCATAAGCTGGCTCAGGAAGTCGCAGAAGCCAGGGTGATGGAA
GAAGCCATGATTATACGGCGGTTATTACTGTCAGGCCGGAAAGAGGGATATATCGCTGCCAATAAAATTG
CACAGAAAGAAGTGCAGATTGCCCTCGATGAATTAGAGGGAGAAATCCAAAATGTCATCTTTGAAAAAGA
TGCGCGCAATAAGTTTGTAACCTCAACTGTCGTCGAATTGTTGTTGCGCGACAATGCCGAGCGTCAGTCA
TCGCTCAACACGCCTGCCTCTACACCTGAAGATCCCCGTCCGTTGAGTAATGGTGGTGTAGAGCCATGA
 Primer design