SecReT4
Protein ID: 333895586
T4SS name [ID]Tfc [748]
Gene symbol-
Locus tagambt_20840
StrainAlteromonas sp. SN2
Repliconchromosome [GenBank: NC_015554] [Browse all T4SS(s) in this replicon]
Location [Strand]4681051..4681413 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDF5Z6Z6
KEGG IDalt:ambt_20840
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.2e-31, Aligned region: 5..117
Protein Sequence: 120 a.a.     [Download]
>gi|333895586|ref|YP_004469461.1| hypothetical protein ambt_20840 [Alteromonas sp. SN2]
MSMERNELLPLRLNAEPSIFRGCSLSELMMLVTIGAVVLVPASIIICGLFGYLMMGVGIGLLLVIGWVVI
GATVLQKLKRGRPLGFYQLRLRLWLEDCHLKKSPFIRHSRVWDVGRRVRP
 
Nucleotide Sequence: 363 bp     [Download]
>gi|333891490|ref|NC_015554.1|:c4681413-4681051 Alteromonas sp. SN2 chromosome, complete genome
ATGTCTATGGAACGCAATGAGCTTTTGCCACTGCGTCTGAATGCCGAGCCGTCGATATTTCGAGGCTGCT
CGCTTTCAGAGTTGATGATGTTAGTGACTATCGGTGCAGTAGTATTGGTGCCTGCCAGTATCATTATTTG
CGGATTGTTCGGTTATTTGATGATGGGTGTGGGAATTGGCCTATTGCTCGTCATCGGCTGGGTAGTCATT
GGTGCCACGGTGCTGCAAAAGCTCAAGCGTGGTCGTCCACTGGGTTTCTACCAGTTGCGGCTGCGCTTAT
GGCTGGAAGACTGCCACCTGAAAAAGTCACCGTTCATTCGCCATAGCCGGGTTTGGGATGTGGGCCGGAG
GGTGCGGCCATGA
 Primer design