SecReT4
Protein ID: 333895605
T4SS name [ID]Tfc [748]
Gene symbol-
Locus tagambt_20935
StrainAlteromonas sp. SN2
Repliconchromosome [GenBank: NC_015554] [Browse all T4SS(s) in this replicon]
Location [Strand]4699996..4700724 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDF5Z715
KEGG IDalt:ambt_20935
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.7e-49, Aligned region: 45..239
Protein Sequence: 242 a.a.     [Download]
>gi|333895605|ref|YP_004469480.1| hypothetical protein ambt_20935 [Alteromonas sp. SN2]
MANSSEYRPPPRKEPSLIGKTISSTVALIVWLILSLLISVIIEWIGMIWFWPEQGADHAKAVLTSDQGYL
NTQLYQNSLNAKRAVAENAKSAVKWIEKQTAFKRHSPRFNPKSSSTVSTVSEWSSKYYRKAKPYLEAAST
VAQTFVVRLALIVFSLPVFVLAGLIGAVDGLVERDLRRWGGGRESSNVFNLAKRSVVPAFVGACVIYISL
PLSINPALVLLPFALLLGLVVRISFERLKKYF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|333891490|ref|NC_015554.1|:c4700724-4699996 Alteromonas sp. SN2 chromosome, complete genome
ATGGCTAACTCATCTGAATATCGACCACCACCGCGCAAAGAACCTAGCCTGATCGGTAAAACTATATCCA
GCACAGTAGCGCTGATTGTCTGGTTAATTCTGAGTTTGCTGATTTCCGTTATCATTGAATGGATTGGCAT
GATCTGGTTTTGGCCAGAACAGGGTGCCGATCATGCGAAAGCGGTACTCACCAGTGACCAAGGCTATCTC
AATACCCAGCTCTACCAGAACTCGCTCAATGCCAAGCGCGCAGTCGCAGAAAATGCGAAAAGCGCTGTAA
AATGGATTGAGAAGCAAACAGCATTCAAAAGACATTCACCTCGCTTTAATCCGAAATCAAGTAGCACTGT
GAGTACCGTTAGCGAATGGAGCAGCAAATACTACCGAAAAGCAAAGCCCTACCTTGAAGCTGCAAGCACC
GTCGCGCAAACCTTTGTCGTCCGTCTAGCATTGATTGTGTTTTCGCTGCCGGTTTTTGTTCTGGCTGGTC
TTATCGGAGCTGTTGATGGTCTGGTTGAGCGAGACCTAAGGCGCTGGGGTGGAGGAAGAGAAAGCAGTAA
CGTCTTTAACCTCGCTAAACGATCTGTAGTGCCAGCTTTTGTTGGGGCTTGCGTGATCTATATCAGCTTG
CCATTGAGTATTAATCCTGCGCTCGTGCTTTTACCTTTTGCATTGCTGCTTGGGTTGGTGGTGCGGATTA
GTTTTGAGCGGCTAAAAAAATACTTTTAG
 Primer design