SecReT4
Protein ID: 333895608
T4SS name [ID]Tfc [748]
Gene symbol-
Locus tagambt_20950
StrainAlteromonas sp. SN2
Repliconchromosome [GenBank: NC_015554] [Browse all T4SS(s) in this replicon]
Location [Strand]4703278..4703814 [-]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDF5Z718
KEGG IDalt:ambt_20950
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 178 a.a.     [Download]
>gi|333895608|ref|YP_004469483.1| lytic transglycosylase, catalytic [Alteromonas sp. SN2]
MSKCAIRKLVVGATLMQSISVAALDDLPIAYVVVAKAANVPADILYAVALAESGRSYKGVLLPWPWTLNV
EGRSIFCESQSEAIILAAEAINRKQLVDIGLTQVNWRWHQQRFSHVDDALVPMLNLKAGAAILREQFEVS
GDWWQAVGRYHDPGQDSESLDSAENYRQRVKRLWRGAF
 
Nucleotide Sequence: 537 bp     [Download]
>gi|333891490|ref|NC_015554.1|:c4703814-4703278 Alteromonas sp. SN2 chromosome, complete genome
ATGAGTAAATGCGCAATTCGAAAGTTAGTGGTGGGCGCGACCCTGATGCAATCCATTTCCGTGGCCGCTC
TGGATGACTTACCTATAGCCTATGTAGTGGTTGCCAAAGCCGCCAATGTGCCCGCCGATATTTTGTATGC
CGTTGCTTTGGCGGAAAGTGGGCGATCTTATAAAGGCGTGCTGTTGCCCTGGCCGTGGACACTGAATGTT
GAAGGTCGGAGTATTTTTTGTGAGTCACAAAGCGAAGCGATTATCTTGGCGGCAGAAGCAATCAACCGTA
AGCAATTGGTTGATATAGGGCTAACCCAAGTGAATTGGCGCTGGCATCAGCAGCGCTTTAGCCATGTCGA
TGATGCGCTCGTTCCCATGCTGAACCTGAAAGCAGGGGCGGCCATTTTGCGCGAACAATTTGAGGTCAGC
GGTGATTGGTGGCAGGCCGTAGGTCGATACCACGATCCAGGACAGGATAGCGAGTCTTTGGATAGCGCGG
AAAACTATCGCCAGCGCGTAAAGCGACTATGGCGAGGGGCATTTTGA
 Primer design