SecReT4
Protein ID: 333900313
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2121
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2260883..2262148 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDF6AAN9
KEGG IDpfv:Psefu_2121
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-57, Aligned region: 225..407
Protein Sequence: 421 a.a.     [Download]
>gi|333900313|ref|YP_004474186.1| conjugation TrbI family protein [Pseudomonas fulva 12-X]
MTAKDNKQTAATSPPPKEAPESLELRAKPRPVTRLNPRMLAVVVGGLSAAVLGAMLWSLQPQQRRQGAEP
NELYNVDRVARSEGLEQLPADYSQLPPPPAPEVPQLGPPLPGDLGGPILRAEQQAQGYGHGPDAPEAERL
ALLKEAEEAAQSSVFFQTSSARKSNVASAGSAQPDPMTLGMVSSGTVAATAGTPTQQERNEAFLSKSVSA
QIRNSGLLQMPESPYQVMAGTVIPAALVTGIKSDLPGDVIATVTEPVYDSATGQHMLIPQGARLLGRYNS
QVSYGQSRVQVVWQRVILPDTSSFQLDNLVGTDAAGYAGLEDGVDWHWDRIVADAAMTSLLGIGAELAAP
ANRTDGDRVIIAGRDSLHDTVNQVGQEVTRRNLDIQPTLTQRPGLPVRVIVNRDLVLPPYQSILSQPRSQ
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2262148-2260883 Pseudomonas fulva 12-X chromosome, complete genome
ATGACGGCCAAGGACAACAAACAAACCGCCGCAACCTCGCCACCGCCCAAGGAAGCGCCGGAGTCGCTGG
AGCTGCGAGCCAAGCCGCGTCCGGTCACCCGCCTCAACCCACGCATGCTGGCGGTAGTGGTCGGCGGCCT
ATCGGCTGCGGTACTGGGGGCCATGCTGTGGTCGCTGCAGCCGCAGCAGCGCCGCCAGGGCGCCGAGCCG
AACGAGCTATACAACGTCGACCGCGTGGCACGCTCCGAGGGGCTGGAGCAGTTGCCGGCAGACTACTCGC
AACTGCCGCCTCCCCCTGCGCCCGAGGTACCGCAACTGGGGCCGCCGCTGCCTGGCGATCTGGGCGGGCC
AATCCTCAGGGCGGAGCAGCAGGCGCAAGGTTATGGACATGGGCCAGATGCCCCCGAAGCAGAGCGCCTA
GCCCTGCTCAAAGAAGCTGAGGAAGCAGCGCAGTCCTCGGTGTTTTTCCAGACCAGCAGCGCGCGGAAAT
CGAACGTCGCATCCGCTGGGAGTGCCCAACCCGATCCTATGACCCTGGGTATGGTCTCGTCAGGCACGGT
AGCCGCAACTGCAGGAACACCAACGCAGCAGGAGCGGAACGAGGCGTTTCTCAGTAAATCCGTAAGTGCA
CAAATCCGTAATTCCGGGTTGCTGCAGATGCCTGAGTCGCCCTACCAGGTGATGGCCGGCACCGTCATCC
CGGCAGCGCTGGTCACCGGCATCAAGTCGGATCTACCTGGCGACGTGATCGCCACAGTGACCGAGCCGGT
CTACGACAGTGCCACCGGTCAGCACATGCTGATTCCACAAGGTGCGCGCCTGCTGGGCCGCTACAACAGC
CAGGTGAGCTACGGACAAAGCCGCGTGCAGGTGGTGTGGCAGCGAGTGATCCTGCCGGACACCTCGTCCT
TCCAGCTCGACAACCTGGTCGGTACTGATGCCGCCGGCTATGCCGGTCTCGAGGATGGCGTCGACTGGCA
TTGGGATCGGATCGTCGCCGACGCGGCCATGACCAGCCTGCTGGGCATCGGTGCCGAGCTGGCGGCACCG
GCCAACCGCACCGACGGCGACCGCGTCATTATCGCGGGGCGTGACAGCCTCCATGACACGGTGAACCAGG
TTGGCCAGGAAGTCACTCGCCGCAATCTCGACATTCAGCCGACGCTGACCCAGCGTCCAGGTCTGCCAGT
TCGCGTGATCGTGAACCGCGATCTGGTCCTGCCCCCTTACCAATCCATCCTCTCTCAGCCAAGGAGCCAG
CAATGA
 Primer design