SecReT4
Protein ID: 333900314
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2122
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2262151..2263137 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF6AAP0
KEGG IDpfv:Psefu_2122
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.8e-68, Aligned region: 101..320
Protein Sequence: 328 a.a.     [Download]
>gi|333900314|ref|YP_004474187.1| P-type conjugative transfer protein TrbG [Pseudomonas fulva 12-X]
MKTSLNLCICPLLLSVLAGCASQQPPVIELDEPVEAQRLPEPPKPIEVVEVPKPLALPAQLKPLPENQRS
QPAKEPADERVRVSRANREARVAPSREGYINAIQVWPYSDGALYQVYASPGRVTAINLQPGEELVTVAAG
DTVRWIVGDTTSGSGDELRTSVLIKPTRLDLKTNLVITTTRRTYLIELSSTEQAWMASVSWDYPKDRMLA
LQRRASAAQAEAPVDAGLALEQLRFRYAISGSNPPWKPLHAFDDGRKVYIQFPAGIAQGELPPLFVIGPE
GDGQLVNYRFRSPYYIVDRLFGAAELRLGADKGDVVRIERTDGVARRP
 
Nucleotide Sequence: 987 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2263137-2262151 Pseudomonas fulva 12-X chromosome, complete genome
ATGAAAACCTCCCTTAACCTCTGTATATGCCCTCTGCTGCTGAGCGTGCTGGCCGGCTGTGCCAGCCAGC
AGCCGCCAGTGATCGAGTTGGATGAACCGGTAGAAGCGCAGCGCCTGCCGGAGCCGCCCAAGCCCATCGA
AGTGGTGGAAGTACCCAAGCCTCTGGCTCTGCCCGCCCAGCTCAAGCCATTGCCGGAAAATCAGCGCAGC
CAACCTGCCAAGGAACCGGCCGATGAGCGCGTGCGGGTCTCGCGCGCCAATCGCGAGGCTCGGGTGGCAC
CGAGCCGGGAAGGCTATATCAACGCCATCCAGGTCTGGCCCTACTCCGATGGCGCGTTGTATCAGGTGTA
CGCCAGCCCGGGTCGGGTGACGGCAATTAACCTGCAGCCCGGCGAGGAACTTGTCACCGTGGCCGCTGGC
GACACCGTGCGCTGGATCGTCGGTGACACCACCAGCGGCAGCGGCGATGAGTTGCGTACCAGCGTGCTGA
TCAAACCGACGCGGCTCGACCTCAAGACCAACTTGGTGATCACCACCACGCGCCGCACCTACCTGATCGA
GCTGAGTTCCACCGAGCAGGCTTGGATGGCGTCGGTGTCCTGGGACTATCCGAAGGATCGCATGCTCGCC
CTGCAACGCCGTGCCAGTGCCGCTCAGGCCGAGGCGCCAGTGGATGCCGGCCTGGCGCTGGAGCAGTTGC
GCTTTCGTTATGCAATCAGCGGCAGCAATCCGCCCTGGAAGCCGCTGCATGCCTTCGACGACGGCCGAAA
GGTGTATATCCAGTTCCCCGCCGGTATCGCCCAAGGCGAGCTGCCACCGCTGTTCGTAATTGGCCCCGAA
GGTGACGGACAGCTGGTCAACTATCGCTTCCGCTCGCCCTACTACATCGTCGACCGTCTATTCGGCGCAG
CCGAGCTGCGCCTGGGCGCCGACAAGGGTGACGTGGTGCGGATCGAGCGCACCGATGGCGTGGCACGGAG
GCCCTGA
 Primer design