SecReT4
Protein ID: 333900315
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2123
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2263134..2263841 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDF6AAP1
KEGG IDpfv:Psefu_2123
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-60, Aligned region: 22..225
Protein Sequence: 235 a.a.     [Download]
>gi|333900315|ref|YP_004474188.1| conjugal transfer protein TrbF [Pseudomonas fulva 12-X]
MRFRRPRVRYSDTPQPITPYQAAAQAWDLRMGSSLAQARNWRLMAFGCLGLALLMAGGLVWRSAQSTVTP
YVVEVDNLGQVRAVGEAASPYQPQDAQIAHHLARFIEQVRSLSIDPVVVRQNWLEAYHSTTDRGAATLND
YARANDPFTRVGKESVSVEVTSVVRASDSSFQVRWIERRFVNGAAAGLERWTAVISLVLQPPRTEEKLRR
NPLGIYVNGLSWSRELDTTEGAKKP
 
Nucleotide Sequence: 708 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2263841-2263134 Pseudomonas fulva 12-X chromosome, complete genome
ATGCGATTCAGGCGTCCACGGGTGCGCTACAGCGACACCCCACAACCCATCACGCCCTACCAGGCCGCAG
CACAAGCCTGGGATCTGCGCATGGGCAGCAGCCTGGCGCAGGCGCGTAACTGGCGGCTGATGGCCTTCGG
TTGTCTGGGCCTGGCGCTGCTGATGGCAGGCGGGCTGGTCTGGCGTTCGGCGCAGTCCACGGTGACGCCC
TACGTGGTGGAGGTCGACAACCTTGGTCAGGTACGTGCGGTCGGCGAAGCCGCCAGCCCTTACCAACCCC
AGGATGCGCAGATCGCGCATCACCTGGCGCGCTTTATCGAGCAGGTGCGCTCGCTATCTATCGATCCGGT
GGTGGTGCGACAGAACTGGCTGGAGGCCTATCACTCCACCACCGACCGAGGCGCAGCCACCCTCAACGAC
TATGCCCGCGCCAATGATCCCTTCACCCGGGTCGGCAAGGAGTCGGTATCGGTGGAAGTCACTAGCGTGG
TGCGTGCCAGCGACAGCTCGTTCCAGGTCCGCTGGATCGAACGTCGTTTCGTGAATGGTGCGGCCGCCGG
CCTGGAGCGCTGGACGGCTGTGATCTCACTGGTACTGCAGCCTCCACGCACCGAGGAAAAGCTGCGCCGC
AACCCGCTCGGCATCTACGTCAACGGCCTGTCCTGGAGCCGTGAGCTGGACACTACGGAAGGAGCCAAGA
AACCATGA
 Primer design