SecReT4
Protein ID: 333900316
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2124
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2263854..2265014 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF6AAP2
KEGG IDpfv:Psefu_2124
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.5e-49, Aligned region: 37..259
Protein Sequence: 386 a.a.     [Download]
>gi|333900316|ref|YP_004474189.1| P-type conjugative transfer protein TrbL [Pseudomonas fulva 12-X]
MNDVSVIDRFLEVFGLYIDTGFGLLGGEVAFLTMTLVVIDMTLAGLFWATGGEDVSVKLIRKILYVGAFA
FIIGNFNALAKIVFNSFAGLGLLASGSGLSHAEFLQPGRLAAIGVDAGGPLLEQISSLSGFPEVFSNLHS
ILVLFLAWLVVIVSFFFLAIQLFVTLVEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVASGIKVLVLA
VIVGIGSGLFAEFQAMPDEPSIDHALVVMLASLALLGLGIFGPGIATGLVSGAPQLGAGTAAGTALGAVG
MAAGAAAVAAGVGGAVLAGARMAPGAARLAIGGARSLAGASSSAATNGAPAASDPATAPAKQPDWARRLQ
RRQQLSQATSTVAHTLRGGDGGGSSPGPQIRDPSNS
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2265014-2263854 Pseudomonas fulva 12-X chromosome, complete genome
ATGAACGACGTCAGCGTGATCGACCGTTTCCTCGAGGTGTTCGGGCTGTACATCGACACCGGCTTCGGCC
TGCTGGGCGGTGAGGTGGCCTTTCTCACCATGACCCTGGTGGTGATCGATATGACCCTGGCCGGGCTGTT
CTGGGCCACGGGTGGCGAGGACGTCAGCGTCAAGCTGATCCGCAAGATCCTCTATGTCGGTGCCTTCGCG
TTCATCATCGGCAACTTCAATGCCCTGGCGAAGATCGTCTTCAACTCCTTCGCCGGGTTGGGTCTGCTGG
CCTCAGGTTCCGGGTTGAGTCATGCGGAATTTCTGCAGCCAGGACGGTTGGCCGCGATTGGCGTTGATGC
CGGAGGGCCGCTGCTTGAGCAGATCAGCAGCCTCAGTGGATTTCCCGAAGTTTTCAGCAACCTGCACAGC
ATTCTGGTGCTGTTTCTGGCCTGGCTGGTGGTGATCGTTAGTTTTTTCTTCCTGGCCATTCAGCTGTTCG
TGACCTTGGTCGAATTCAAGCTGACCACCCTCGCCGGCTTCGTGCTGGTGCCCTTCGCGCTGTGGAATAA
GACCGCCTTTCTCGCCGAGAAGGTGCTGGGCAACGTGGTCGCGTCCGGCATCAAGGTGCTGGTGCTGGCG
GTAATCGTCGGCATTGGCAGCGGGCTGTTCGCCGAGTTCCAGGCTATGCCGGACGAGCCCTCCATCGACC
ATGCGCTGGTGGTCATGCTCGCCTCTCTGGCCCTGCTGGGCCTGGGCATCTTCGGGCCGGGCATTGCCAC
CGGGTTGGTCTCCGGCGCACCGCAACTGGGTGCTGGTACAGCAGCCGGCACTGCACTCGGCGCGGTGGGC
ATGGCTGCTGGTGCTGCTGCAGTCGCCGCAGGTGTCGGGGGCGCGGTATTGGCCGGCGCACGTATGGCAC
CCGGTGCAGCACGCTTGGCAATTGGCGGCGCTCGCTCTCTGGCAGGAGCTTCTTCCAGCGCTGCAACAAA
TGGCGCCCCAGCAGCTTCCGATCCTGCAACCGCCCCAGCCAAACAGCCCGACTGGGCCAGGCGCCTGCAG
CGCAGGCAACAACTCTCACAGGCCACCAGCACGGTCGCCCACACCCTGCGTGGTGGCGATGGCGGTGGTT
CATCACCTGGGCCGCAGATCCGCGACCCATCGAACTCGTAA
 Primer design