SecReT4
Protein ID: 333900318
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2126
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2265209..2265943 [-]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF6AAP4
KEGG IDpfv:Psefu_2126
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|333900318|ref|YP_004474191.1| P-type conjugative transfer protein TrbJ [Pseudomonas fulva 12-X]
MRSPVHRFPCATLLVLGLLAVKPASAFTVIDPTNLVQNTLTAVRTLEMANNQVRQLQNETQMLLNQARHL
QRLDYNVISQLRASLANTERLLAEARGLAYEVQRLDQEFSRLYSNEYTADVSSQRLAKEARERWQKGLDG
LHTALRVQAQVTQNLAEDESALATLVQQSQSAGGALQAAQATNQLLALQAKQSIQAQQLQITQNRAVALE
LARQSAAAEEARERRRRFMGSGTPYTPYPVQFYR
 
Nucleotide Sequence: 735 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2265943-2265209 Pseudomonas fulva 12-X chromosome, complete genome
ATGAGATCCCCTGTTCACCGTTTCCCCTGCGCCACGCTGCTGGTACTGGGTCTGCTGGCCGTGAAGCCGG
CCAGCGCTTTCACCGTGATCGATCCGACCAACCTGGTGCAGAACACGCTGACTGCAGTACGCACCCTGGA
GATGGCGAACAACCAGGTCCGCCAGTTACAGAACGAAACCCAGATGCTGCTGAACCAGGCCCGTCATCTG
CAGCGCCTGGACTACAACGTGATCAGCCAGTTGCGCGCAAGCCTGGCCAACACCGAGCGGCTGCTCGCAG
AGGCTCGGGGGCTGGCCTACGAAGTGCAACGCCTGGATCAGGAGTTCAGCCGCCTTTACTCGAACGAGTA
CACCGCCGACGTAAGCAGCCAGCGCCTGGCAAAAGAAGCACGCGAACGCTGGCAGAAGGGCCTCGACGGG
CTGCATACGGCGCTGCGTGTACAGGCCCAGGTGACGCAGAACCTGGCCGAGGATGAGAGCGCCTTGGCCA
CTCTGGTGCAGCAGAGCCAGTCGGCGGGTGGCGCCTTGCAGGCTGCCCAGGCCACCAACCAACTGCTGGC
CCTGCAGGCCAAGCAGTCGATCCAGGCGCAGCAACTGCAGATCACCCAGAACCGCGCCGTCGCCTTGGAG
CTTGCCCGTCAGTCTGCAGCAGCCGAAGAGGCGCGCGAACGGCGGCGACGCTTTATGGGCAGCGGCACAC
CCTACACCCCCTACCCAGTGCAGTTCTATCGGTAG
 Primer design