SecReT4
Protein ID: 333900319
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2127
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2265940..2268369 [-]
ProductCagE, TrbE, VirB component of type IV transporter system
Component typeTrbE
UniProt IDF6AAP5
KEGG IDpfv:Psefu_2127
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-41, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 2.5e-15, Aligned region: 183..388
DUF853 [PF05872], Evalue: 4.3e-07, Aligned region: 609..684
Protein Sequence: 809 a.a.     [Download]
>gi|333900319|ref|YP_004474192.1| CagE, TrbE, VirB component of type IV transporter system [Pseudomonas fulva 12-X]
MLNLTEYQRRPAQLADWLPWAGLVAPGVVLNKDGSFQRSLRFRGPDLDSATQGELVATSARLNNALRRLG
SGWALFVEAERLAAADYPNSDFPEPLSWLVDEERRAACEAQGSHFESSYHLTLVYLPPEESRSRAAGLLY
EHRPQRDVDWRERLTAFVAETDRFFDLLDGVMPELAWLDDSQTLTYLHATVSTHRQRLAVPEVPFHLDAL
LADSPLTTGLAPRLGEQHLRTLSVRGFPTSTWPGVLDDLNRLGFAYRWSTRFICLEKDEAEKELVRLRRQ
WFAKRKGVLALLREAIFQQESPLLDSDAANKAGDADEALQELGADQVAFGYVTATVMVSDVDAQIADEKL
RRVERVIQGRGFVTIAESLNAVEAWLSSIPGNVYANVRQPLISTLNLAHLMPVSAVWAGPARNEHLDGTP
LVITRTDGATPFRLVTHVGDVGHTLVAGPTGMGKSVLLATLALQFRRYPGSRLFLFDMGRSLRATVLGLG
GEHYNLGGDGDLAFQPLARIDQPGYRAWAADWLEARLLQEGVAVDPEQKAALWTALDSLAGAPEAQRTLT
GLSVLLQDNILRQALQPYVLGGAHGALLDAEQDRLGNADVQCFEMEELMYSKAAVAAVLSYLFARFEERF
DGAPTLLILDEAWLFLDDPLFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAAAIIESCASRIFLPN
PQAGEPQIRGIYQGFGLNDRQIEIIAQATPKRDYYYQSRLGSRLFDLDLGPVALAFAASASPAEQREIDR
ILQTSGAADFAPAWLHHRGLDWAADLLTAYPSSRKECLP
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2268369-2265940 Pseudomonas fulva 12-X chromosome, complete genome
ATGCTGAACCTCACCGAATACCAGCGCCGCCCCGCCCAGCTCGCCGACTGGCTACCCTGGGCCGGTCTGG
TCGCACCCGGCGTCGTATTGAACAAGGACGGTTCGTTCCAACGCAGCCTGCGCTTTCGCGGGCCAGACCT
GGACAGCGCCACCCAAGGCGAGCTGGTGGCCACCTCGGCGCGCCTGAACAATGCCCTGCGTCGCCTTGGC
TCGGGCTGGGCGCTGTTTGTCGAGGCCGAGCGTCTGGCGGCGGCCGATTACCCCAACAGCGACTTTCCCG
AACCACTGTCCTGGCTGGTGGACGAGGAGCGCCGCGCCGCCTGCGAGGCCCAGGGCAGCCACTTCGAGAG
CAGCTATCACCTGACGCTGGTCTACCTGCCGCCGGAAGAATCGCGCTCGCGCGCCGCCGGCCTGCTCTAT
GAGCACCGGCCGCAACGCGACGTCGACTGGCGCGAAAGGCTGACTGCCTTTGTCGCCGAAACGGATCGTT
TCTTCGATCTGCTGGACGGGGTGATGCCGGAGCTCGCCTGGCTCGATGACAGCCAGACGCTGACTTACTT
GCATGCCACGGTTTCGACCCATCGCCAGCGGTTGGCTGTACCCGAGGTGCCCTTCCACCTCGATGCCCTG
CTGGCCGACAGCCCCCTGACCACGGGCCTAGCGCCGCGTCTCGGTGAGCAGCATCTGCGCACGCTGTCGG
TACGTGGCTTCCCCACCTCGACCTGGCCAGGCGTGCTGGACGACCTCAACCGTCTGGGCTTCGCCTATCG
CTGGTCGACCCGCTTTATCTGCCTGGAAAAGGACGAGGCCGAGAAGGAACTGGTGCGCCTGCGCAGGCAG
TGGTTCGCCAAGCGCAAGGGCGTCCTGGCACTACTGCGCGAAGCGATTTTCCAGCAGGAAAGCCCACTGC
TCGACAGCGACGCCGCGAACAAGGCCGGCGACGCCGACGAGGCACTACAGGAACTCGGCGCCGACCAGGT
CGCCTTCGGCTATGTGACGGCCACCGTGATGGTGAGCGATGTCGACGCCCAGATCGCCGACGAGAAGCTG
CGCCGGGTCGAGCGGGTAATCCAGGGCCGCGGCTTCGTCACCATCGCCGAGAGTCTCAACGCGGTGGAGG
CGTGGCTATCGTCGATCCCCGGCAACGTCTACGCCAATGTCCGCCAGCCGCTGATCTCCACACTCAACCT
GGCGCACTTGATGCCGGTCTCGGCAGTCTGGGCTGGGCCGGCACGCAACGAACATCTGGATGGCACGCCA
TTGGTGATCACCCGCACCGATGGAGCAACACCATTTCGCCTGGTCACCCACGTTGGCGATGTCGGACACA
CCTTGGTGGCTGGCCCCACGGGCATGGGCAAATCGGTTTTGCTGGCAACCCTGGCCCTGCAGTTCCGCCG
CTACCCGGGCTCGCGCCTGTTTCTGTTCGATATGGGGCGCTCGCTGCGCGCAACGGTGCTGGGCCTGGGT
GGCGAGCACTACAACCTCGGAGGCGACGGCGACCTGGCCTTCCAGCCTCTGGCGCGCATCGATCAGCCGG
GATACCGAGCCTGGGCCGCCGATTGGCTGGAGGCGCGCCTGCTGCAGGAAGGTGTGGCCGTCGACCCCGA
GCAGAAAGCCGCGCTGTGGACGGCGCTGGACAGTCTGGCCGGCGCGCCCGAAGCGCAGCGCACACTGACC
GGTTTATCCGTGCTGCTGCAGGACAACATCCTGCGCCAGGCGCTGCAGCCCTACGTGCTGGGCGGCGCGC
ATGGCGCATTGCTGGATGCCGAGCAGGATCGTCTGGGCAACGCCGACGTGCAGTGTTTCGAGATGGAGGA
ACTGATGTACAGCAAGGCGGCGGTGGCTGCCGTGCTGAGCTACCTGTTCGCCCGTTTCGAGGAGCGCTTT
GACGGCGCGCCGACACTGCTGATCCTCGACGAGGCCTGGCTGTTTCTCGACGATCCGCTATTCGCCGCGC
GCATCCGCCAGTGGCTCAAGACCCTGCGCAAGAAGAACGTCAGCGTCATCTTCGCCACCCAGTCGCTGGC
CGACATCAAGGACTCCAGCATCGCTGCCGCGATTATCGAGAGCTGCGCCAGCCGCATCTTCCTACCCAAC
CCGCAGGCGGGCGAGCCGCAGATCCGCGGCATCTACCAAGGCTTCGGACTGAACGACCGGCAGATCGAGA
TCATCGCCCAGGCCACGCCCAAGCGTGATTACTACTACCAGTCGCGCCTGGGCAGCCGCCTGTTCGACCT
CGACCTCGGGCCGGTGGCGCTGGCCTTCGCTGCCTCGGCCAGCCCGGCCGAGCAGCGCGAGATCGACCGA
ATTTTGCAGACGTCCGGCGCCGCCGATTTCGCCCCTGCCTGGTTGCATCACCGCGGCCTGGATTGGGCCG
CCGACCTGCTCACCGCTTATCCCTCGTCACGCAAGGAGTGCCTGCCATGA
 Primer design