SecReT4
Protein ID: 333900320
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2128
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2268380..2268652 [-]
Productconjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDF6AAP6
KEGG IDpfv:Psefu_2128
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.8e-10, Aligned region: 6..82
Protein Sequence: 90 a.a.     [Download]
>gi|333900320|ref|YP_004474193.1| conjugal transfer TrbD transmembrane protein [Pseudomonas fulva 12-X]
MNGERDLIPGFEVPLHRSLAEPILLGGAPRNVAILNGTLAAVVGLGLQLWLPGLALWLVGHSLAVWGARL
DPQFLQVFARHIKQPSLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2268652-2268380 Pseudomonas fulva 12-X chromosome, complete genome
ATGAACGGCGAGCGCGACCTCATCCCCGGTTTCGAGGTGCCATTGCACCGCTCGCTGGCCGAGCCGATTT
TGCTTGGTGGCGCACCACGCAACGTGGCGATCCTCAACGGCACTCTGGCAGCAGTGGTCGGCCTGGGCCT
GCAGCTGTGGCTGCCTGGCTTGGCACTTTGGTTGGTCGGCCACTCGCTGGCGGTCTGGGGTGCCCGTCTG
GATCCGCAGTTCCTGCAGGTGTTCGCCCGGCATATCAAGCAGCCGTCGCTGCTGGATGTGTGA
 Primer design