SecReT4
Protein ID: 333900321
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2129
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2268649..2268990 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDF6AAP7
KEGG IDpfv:Psefu_2129
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-24, Aligned region: 11..102
Protein Sequence: 113 a.a.     [Download]
>gi|333900321|ref|YP_004474194.1| conjugal transfer protein Trbc [Pseudomonas fulva 12-X]
MTVLQLSAAYRRRGACALMLGAFCLGASLPVLAAGSGMPWEGPLQSILDSVQGPVARIIAVIIIITTGLT
LAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFAGGAVIA
 
Nucleotide Sequence: 342 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2268990-2268649 Pseudomonas fulva 12-X chromosome, complete genome
ATGACTGTGCTTCAGCTTTCCGCTGCTTATCGTCGCCGCGGCGCCTGCGCCTTGATGCTCGGCGCCTTCT
GCCTGGGCGCTTCCCTGCCCGTGCTCGCCGCCGGCTCCGGCATGCCCTGGGAGGGACCGCTGCAATCGAT
CCTCGACTCGGTACAGGGTCCGGTGGCGCGCATCATCGCGGTGATCATCATCATTACCACCGGCCTGACG
CTGGCCTTCGGCGACACCAGCGGCGGCTTTCGCAAGCTGATCCAGATCGTCTTCGGCCTGTCGATTGCCT
TCGCCGCGTCGTCGTTCTTCCTCAGCTTTTTCAGCTTTGCCGGCGGGGCGGTGATCGCATGA
 Primer design