SecReT4
Protein ID: 333900322
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2130
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2268987..2269994 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDF6AAP8
KEGG IDpfv:Psefu_2130
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.1e-83, Aligned region: 30..295
TrwB_AAD_bind [PF10412], Evalue: 2.3e-05, Aligned region: 151..188
FtsK_SpoIIIE [PF01580], Evalue: 5.1e-05, Aligned region: 147..179
Protein Sequence: 335 a.a.     [Download]
>gi|333900322|ref|YP_004474195.1| P-type conjugative transfer ATPase TrbB [Pseudomonas fulva 12-X]
MNSSSSIVLNAAATSLDRCTRMLRTAMGPLIAAALDDPDVVEVMLNPDGLLWLDRLSVGRAHLGTLAAAD
GERIIRLVAAHVGAEVHRGRPLLSAELSETGERFEGVLPPVVAGPTFALRKRAAGVIPLQQYVADGILSA
TQAKYLRVAVRERQNILVAGGTSSGKTTLANALLAEVADSGDRVMVLEDTVELQCPARDHVALRTKPGVV
SMADLVRSTLRLRPDRVVVGEVRGGEALDLVKAWGTGHPGGIATIHAGSAQGALLRLEQLILEVALAAPR
ALIAEAVNLVVFLAGRGRARHVQQIARVIGHDERGYQLSALDTLLCSTSASGTQP
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2269994-2268987 Pseudomonas fulva 12-X chromosome, complete genome
ATGAACAGCTCCTCTTCCATCGTGCTGAACGCGGCGGCGACCTCCTTGGATCGTTGCACCCGCATGTTGC
GCACGGCGATGGGCCCGCTGATCGCGGCGGCCCTGGATGATCCGGACGTGGTCGAGGTGATGCTCAACCC
CGACGGCCTGCTCTGGCTGGATCGCCTGTCAGTTGGCCGCGCCCATCTGGGCACGCTGGCAGCTGCCGAC
GGCGAGCGGATCATCCGCCTGGTGGCCGCGCATGTCGGCGCGGAAGTGCATCGTGGCAGGCCGCTGCTGA
GCGCCGAGCTGTCGGAAACCGGCGAGCGCTTCGAGGGCGTGCTGCCGCCGGTGGTGGCCGGGCCGACCTT
CGCGCTGCGCAAGCGCGCCGCTGGCGTAATCCCGCTGCAGCAGTACGTCGCCGACGGCATCCTCAGCGCC
ACCCAGGCCAAGTACCTGCGCGTGGCCGTGCGCGAGCGGCAGAACATCCTGGTGGCCGGCGGTACGAGCA
GCGGCAAGACCACGCTGGCCAACGCACTGCTGGCCGAGGTGGCCGACAGCGGCGATCGCGTGATGGTGCT
GGAGGACACGGTCGAGCTGCAGTGCCCGGCTCGCGATCACGTCGCCCTGCGTACCAAGCCTGGCGTGGTG
TCCATGGCCGACCTGGTGCGCAGCACGCTGCGCCTGCGCCCAGACCGCGTGGTGGTCGGCGAGGTGCGCG
GCGGCGAGGCGCTGGACCTGGTCAAGGCCTGGGGCACCGGCCATCCCGGCGGTATCGCGACGATTCACGC
CGGCTCCGCGCAGGGTGCTCTGCTGCGCCTGGAGCAACTGATCCTGGAGGTTGCCCTGGCCGCGCCAAGG
GCGCTGATCGCCGAGGCGGTGAACCTGGTGGTGTTCCTCGCCGGGCGCGGCCGCGCCCGCCATGTCCAGC
AGATCGCCCGCGTCATCGGCCATGACGAGCGCGGCTACCAGCTCAGCGCCCTCGACACCCTCCTTTGCTC
CACCTCTGCCTCAGGAACTCAGCCATGA
 Primer design