SecReT4
Protein ID: 333900324
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2132
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2270422..2272413 [-]
ProductTRAG family protein
Component typeTraG
UniProt IDF6AAQ0
KEGG IDpfv:Psefu_2132
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-102, Aligned region: 115..556
TraG-D_C [PF12696], Evalue: 1.4e-30, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 1.4e-29, Aligned region: 172..538
AAA_10 [PF12846], Evalue: 3e-06, Aligned region: 371..480
Protein Sequence: 663 a.a.     [Download]
>gi|333900324|ref|YP_004474197.1| TRAG family protein [Pseudomonas fulva 12-X]
MQATTVLYGQVLVVLTITLSGVWGATQWTAAALGYQARLGAPWFELLGTPVYHPWRLFEWWFVFDAYAPD
IFNVGGSIAACSSLLALVVAIGMAIWRARQARRVTTYGSARWADADEVRKAGLTQTAGVFLGQFDDQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWSLTAGWRSRFSHCLLFNPTDLASAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGKDKTLRGVANFLSDPA
CTFELTLHRMMTTPHLGDAPHTVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLISAEHPVSLYLVVPPSDISRTKPLIRLILNQVGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGLRAFLISQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPSDEAVVMLSGLAPIRAKKLRYFTDTNFQSRVQPAPR
LQPGRYADTPAPRADDWSSLAVPVVVAASPTDLSDDETIEDGGPRRQPELTEFAELPDHDELASDLLLLD
EDDISTPFPTQPDPRLQRVARLAALDPDDGIAL
 
Nucleotide Sequence: 1992 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2272413-2270422 Pseudomonas fulva 12-X chromosome, complete genome
ATGCAAGCGACAACGGTGCTGTACGGCCAGGTGCTGGTGGTGTTGACCATCACTCTGTCCGGGGTCTGGG
GTGCCACGCAGTGGACAGCTGCCGCGCTCGGCTACCAGGCGCGCCTGGGGGCGCCCTGGTTCGAGCTGCT
GGGCACGCCGGTGTATCACCCCTGGCGTCTATTCGAGTGGTGGTTCGTCTTCGACGCCTATGCACCGGAC
ATCTTCAACGTCGGCGGCAGCATCGCCGCCTGCAGCAGTCTGCTGGCGTTGGTGGTGGCCATTGGTATGG
CGATCTGGCGCGCACGCCAGGCTCGACGGGTCACCACCTACGGTTCGGCGCGTTGGGCCGATGCAGATGA
GGTGCGCAAGGCCGGCCTGACCCAGACAGCGGGTGTATTCCTCGGCCAGTTCGACGATCAGTATCTTCGC
CACGAAGGCCCCGAGCATGTGCTGACCTTCGCGCCGACGCGCTCGGGCAAGGGCGTCGGCCTGGTGGTAC
CCACCCTGCTCTCATGGCCTGCCTCAGCAGTCATCCACGACATCAAGGGCGAGAACTGGAGCCTGACCGC
GGGCTGGCGTTCGCGCTTCTCCCACTGCCTGTTGTTCAACCCCACTGACCTGGCCTCGGCCGCCTATAAC
CCGTTACTGGAAGTACGTCGCGGCGCCCACGAGGTACGCGACGTACAGAACATCGCCGATATTCTGGTCG
ACCCAGAAGGCGCGCTGGAGCGGCGCAACCATTGGGAGAAGACCAGTCATGCGCTGCTGGTCGGCGCCAT
CCTGCACGTACTCTACGCCGGCAAGGACAAGACCCTGCGCGGCGTCGCCAACTTCCTCTCAGATCCAGCC
TGCACCTTCGAGCTGACCCTGCACCGGATGATGACCACACCGCATCTAGGCGATGCACCCCATACGGTGG
TGGCCTCTGCGGCGCGGGAGGTGCTGAACAAGAGCGACAACGAGCGCTCGGGCGTGCTGTCCACGGCCAT
GTCCTTCCTCGGCCTGTATCGCGACCCGACCGTGGCCGAGGTCACCTCGCGCTGCGACTGGCGCATCGCC
GACCTGATCTCGGCCGAGCATCCGGTGTCGCTGTACCTGGTCGTACCGCCCTCGGATATCAGCCGCACCA
AGCCGCTGATCCGCCTGATCCTCAACCAGGTCGGCCGGCGCCTGACCGAGTCGCTCGACGGCTCCGACGG
CATCGAGCGCCGGCACAAGCTGCTGCTGATGCTCGATGAGTTTCCGGCGCTGGGACGGCTGGATTTCTTC
GAGACGGCCCTGGCCTTCATGGCCGGCTACGGGTTGCGCGCCTTCCTGATCTCGCAGTCGCTGAACCAGA
TCGACAAGGCCTACGGCCAAAACCATTCGATCCTCGACAACTGCCATGTACGGGTGACCTTCGCCACCAA
CGACGAGCGCACCGCCAAGCGCATCTCAGAGACCCTCGGCACTGCCACAGAACTGCGCGCGCAGCGCAAC
TACGCCGGTCACCGCCTCGCACCCTGGCTGGGCCATCTGATGGTGTCGCGCCAGGAAACCGCCCGCCCGC
TGCTGACCCCGGGCGAGGTGATGCAGCTGCCCAGCGACGAGGCCGTGGTGATGCTCTCCGGCCTCGCACC
GATCCGCGCGAAGAAGCTGCGCTACTTCACCGACACCAACTTCCAGAGCCGGGTACAGCCGGCGCCGCGC
TTGCAGCCGGGTCGCTACGCCGACACACCGGCGCCGCGCGCGGACGACTGGAGCAGCCTGGCCGTGCCCG
TAGTCGTTGCCGCGTCGCCGACCGATCTGAGCGATGACGAGACCATCGAGGACGGCGGCCCACGCCGTCA
GCCCGAGCTGACGGAGTTCGCCGAGTTGCCGGATCACGACGAGCTGGCCAGCGACCTGCTGCTGCTCGAC
GAGGACGACATTTCCACGCCCTTCCCCACCCAGCCGGATCCACGCCTGCAGCGCGTGGCGCGGCTGGCCG
CCCTCGACCCTGACGATGGAATAGCCCTATGA
 Primer design