SecReT4
Protein ID: 333900337
T4SS name [ID]Trb [314]
Gene symbol-
Locus tagPsefu_2145
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T4SS(s) in this replicon]
Location [Strand]2286806..2287333 [-]
Productpeptidase S26, conserved region
Component typeTraF
UniProt IDF6AAR3
KEGG IDpfv:Psefu_2145
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.2e-51, Aligned region: 34..171
Protein Sequence: 175 a.a.     [Download]
>gi|333900337|ref|YP_004474210.1| peptidase S26, conserved region [Pseudomonas fulva 12-X]
MTATARRRRWPLALIAGSLFALTWAAFSTPMPRLVYNASDSLPIGWYHIEAPRSLRPGDTVLINLPHKVR
TFAAQRGYLPESIPLMKTVAAIAPQHVCVLSGLIVVDSEPVAIRLHVDRKGRALPQWSGCRQLDEGELFL
LSTTNPESFDSRYFGPVPVDSVIGRAQPLWVEARP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c2287333-2286806 Pseudomonas fulva 12-X chromosome, complete genome
ATGACAGCTACCGCGCGCCGTCGCCGATGGCCATTGGCACTGATAGCAGGCAGTTTGTTCGCATTGACCT
GGGCAGCGTTTTCCACGCCAATGCCGCGGCTGGTTTACAACGCCTCAGACAGCCTACCCATAGGCTGGTA
TCACATCGAGGCGCCTCGCTCATTGCGCCCGGGCGACACGGTGCTGATCAACTTGCCTCACAAGGTGAGA
ACGTTCGCAGCGCAACGAGGCTACCTGCCTGAGAGCATCCCGTTGATGAAGACCGTGGCGGCCATCGCTC
CCCAGCACGTATGCGTGCTGAGCGGCTTGATCGTTGTCGACAGTGAACCTGTCGCGATTCGCTTGCACGT
TGATCGCAAAGGCCGCGCTCTGCCCCAGTGGAGTGGCTGTCGACAGCTGGATGAAGGCGAACTGTTTCTA
CTGAGCACCACCAATCCGGAGTCATTCGACAGTCGTTACTTTGGTCCTGTGCCTGTCGACTCGGTGATAG
GTCGAGCGCAGCCACTTTGGGTGGAAGCACGCCCATGA
 Primer design