SecReT4
Protein ID: 333925172
T4SS name [ID]Tfc [679]
Gene symbol-
Locus tagSerAS12_0280
StrainSerratia sp. AS12
Repliconchromosome [GenBank: NC_015566] [Browse all T4SS(s) in this replicon]
Location [Strand]330295..330981 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDG0BJF3
KEGG IDsrs:SerAS12_0280
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 228 a.a.     [Download]
>gi|333925172|ref|YP_004498751.1| lytic transglycosylase catalytic subunit [Serratia sp. AS12]
MDTRRVLTRGLLPLFAFLTSVGGGVVHAVTQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIVSVT
RGAGPAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWAA
FEPYTNLNAAAAILRECYDRNPGSWLVAAGCYHHPAGGAPAARYKSIVSGKLARLNGKASAPIRMTSTMP
TALPAQTAALTWIEPRSQ
 
Nucleotide Sequence: 687 bp     [Download]
>gi|333924895|ref|NC_015566.1|:330295-330981 Serratia sp. AS12 chromosome, complete genome
ATGGACACTCGCCGCGTTCTGACCCGGGGGCTATTGCCCCTGTTTGCCTTCCTCACTTCTGTGGGGGGCG
GAGTCGTTCATGCTGTTACCCAGCAGGTACCCTCCGGTTATCGGGAGGTGGCGTTGCGTCACGGGGTTCC
TCCTGAGTCCCTGTATTCAGTTGCGTTGGCCGAGACATCGATGGCCCCGAAAAGCATTGTTTCAGTGACC
CGCGGCGCCGGTCCGGCCCCGGATGTGGAGCGTCCCTGGCCCTGGACCATCAATGTTGCCGGTAAAGGGT
ATCGCTATGCCAGCCGCCTGCAAGCCTGGGAAGCCTTGCAGCGTTTTTTGAAAACACATCCTCGCAAGCG
CATTGATGTCGGGATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTCACGTCGACCTGGGCGGCG
TTTGAACCGTACACCAACCTCAACGCCGCCGCGGCCATCCTGCGGGAGTGCTATGACCGCAACCCCGGTA
GCTGGCTGGTTGCCGCCGGGTGTTATCACCATCCTGCCGGCGGAGCGCCCGCTGCCCGGTATAAATCCAT
CGTGAGCGGCAAGCTGGCACGCCTAAACGGCAAGGCATCCGCCCCGATCCGGATGACCAGCACTATGCCC
ACGGCGTTACCGGCACAAACGGCGGCGCTGACCTGGATTGAACCACGGAGCCAATAA
 Primer design