SecReT4
Protein ID: 333925176
T4SS name [ID]Tfc [679]
Gene symbol-
Locus tagSerAS12_0284
StrainSerratia sp. AS12
Repliconchromosome [GenBank: NC_015566] [Browse all T4SS(s) in this replicon]
Location [Strand]334193..334951 [+]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDG0BJF7
KEGG IDsrs:SerAS12_0284
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.6e-75, Aligned region: 49..249
Protein Sequence: 252 a.a.     [Download]
>gi|333925176|ref|YP_004498755.1| integrating conjugative element membrane protein [Serratia sp. AS12]
MSQAVNNQPQQPVQPRKHGVFYNVLWGWPWMLIGMFFASLLVSLVIEYVGMAFFWPELGASHSEAVMHTE
MGYLSSEFTRSLMLSEPSVTVTRWIGQAYQWTFVDSGFLDWIQRAYDSQVHSQNAVARELNNWSGWLAAT
LKEYLVATVYVTVITLVRVTILVLSIPLFILVVLVALTEGLGRRDIRRYGAGYESSFVYHHAKRMVKPAI
YIPCMLYLSWPTAVYPNLLLLPAAILLGIAVTVTTASFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|333924895|ref|NC_015566.1|:334193-334951 Serratia sp. AS12 chromosome, complete genome
ATGTCACAAGCGGTGAATAATCAGCCTCAGCAGCCCGTACAACCTCGCAAGCATGGGGTGTTTTACAACG
TACTGTGGGGCTGGCCATGGATGCTGATCGGGATGTTCTTCGCCTCGTTGTTAGTGAGCTTGGTGATTGA
GTATGTCGGGATGGCATTCTTCTGGCCAGAGCTTGGCGCGTCGCACAGTGAAGCGGTGATGCATACCGAA
ATGGGGTATTTGTCATCGGAGTTTACCCGCAGTCTGATGTTGTCTGAGCCGTCAGTCACCGTCACGCGGT
GGATTGGCCAGGCGTATCAGTGGACCTTCGTGGACAGCGGTTTTTTGGACTGGATCCAACGTGCCTATGA
TTCGCAGGTGCACAGCCAGAATGCGGTGGCCCGAGAGCTGAACAATTGGAGTGGCTGGCTGGCCGCCACG
CTCAAGGAGTACCTGGTGGCAACAGTGTATGTCACCGTCATCACCCTGGTGCGGGTGACCATTCTTGTGC
TGTCCATCCCGCTGTTTATCCTGGTGGTCCTGGTTGCGCTGACAGAAGGCCTGGGGCGGCGTGATATCCG
TCGTTATGGCGCCGGCTATGAAAGCAGCTTTGTCTACCATCATGCGAAAAGAATGGTAAAGCCGGCTATC
TATATTCCCTGCATGCTGTATCTGTCCTGGCCAACGGCGGTATATCCCAACCTGCTGCTGTTGCCGGCCG
CTATCCTGCTCGGTATTGCGGTGACGGTAACCACAGCCTCCTTCAAAAAATACCTGTAG
 Primer design