SecReT4
Protein ID: 333925178
T4SS name [ID]Tfc [679]
Gene symbol-
Locus tagSerAS12_0286
StrainSerratia sp. AS12
Repliconchromosome [GenBank: NC_015566] [Browse all T4SS(s) in this replicon]
Location [Strand]335541..335876 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDG0BJF9
KEGG IDsrs:SerAS12_0286
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-30, Aligned region: 25..106
Protein Sequence: 111 a.a.     [Download]
>gi|333925178|ref|YP_004498757.1| hypothetical protein SerAS12_0286 [Serratia sp. AS12]
MRIPVVVTRGLGASCLLGLSFLIALPACAAEKDELASAQRMLIQVQAALERARVAAVQADQSERGRFFFD
YARATSDLKTINAGIDRYLEPSRAQPRDGSAVAGNYRRERP
 
Nucleotide Sequence: 336 bp     [Download]
>gi|333924895|ref|NC_015566.1|:335541-335876 Serratia sp. AS12 chromosome, complete genome
ATGCGTATCCCCGTAGTCGTCACCCGAGGATTGGGCGCCAGCTGTTTGCTGGGGTTGTCCTTCCTTATCG
CACTGCCTGCCTGTGCTGCTGAAAAAGATGAGTTGGCGTCTGCTCAACGCATGTTGATTCAGGTGCAGGC
AGCACTTGAACGCGCGCGCGTTGCCGCCGTTCAGGCCGACCAGTCCGAGCGTGGTCGTTTCTTTTTCGAC
TATGCCCGTGCCACGTCCGATCTGAAAACTATCAATGCCGGTATTGACCGCTATCTGGAGCCATCGCGCG
CGCAACCGCGTGATGGCAGCGCTGTGGCTGGCAATTACCGTCGGGAGCGTCCCTGA
 Primer design