SecReT4
Protein ID: 333925181
T4SS name [ID]Tfc [679]
Gene symbol-
Locus tagSerAS12_0289
StrainSerratia sp. AS12
Repliconchromosome [GenBank: NC_015566] [Browse all T4SS(s) in this replicon]
Location [Strand]336551..336916 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDG0BJG2
KEGG IDsrs:SerAS12_0289
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.6e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|333925181|ref|YP_004498760.1| hypothetical protein SerAS12_0289 [Serratia sp. AS12]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRLKRGKPENYIWQRLEARKRRMGWGDPTLIIDKQGWSLRRSRVVKRST
 
Nucleotide Sequence: 366 bp     [Download]
>gi|333924895|ref|NC_015566.1|:336551-336916 Serratia sp. AS12 chromosome, complete genome
ATGCAGACTATCCGATTTTTGCCTGACCGTCTTAACGCTGAGCCTGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGACTGGCGGCGTTGGCCGGGGTGGGACTGGGTCTGCTCGTGTCGTTGCCGTTTTTTCCGCT
TGCCGGTTGGGTCGTGATACCCACCGGCATGCTGGTGACCCCTCTCCTCGTTATCTGGTTTGGTGGCAGC
CGGCTGACGCGCCTCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCGCGTAAACGTC
GCATGGGGTGGGGTGATCCCACCCTGATTATCGACAAACAGGGCTGGTCGTTGCGCCGCAGCCGCGTTGT
TAAGAGGTCAACATGA
 Primer design