SecReT4
Protein ID: 333925193
T4SS name [ID]Tfc [679]
Gene symbol-
Locus tagSerAS12_0301
StrainSerratia sp. AS12
Repliconchromosome [GenBank: NC_015566] [Browse all T4SS(s) in this replicon]
Location [Strand]347898..349382 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDG0BJH4
KEGG IDsrs:SerAS12_0301
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|333925193|ref|YP_004498772.1| integrating conjugative element protein [Serratia sp. AS12]
MNNTMNKRTFRGRRSLLSLWVVSSLMLVGMNAHADDNDDNGTLFGISLPQVNDSNIGYGKSASGAVSDKL
FYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVA
SLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADTGGWSQAAAMEEAKSLVNNGDA
DAVRSMNATEKVTGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGSCA
KYASSEEAAAAVVKVLGDSSLRTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKANNEQLAKLVNGA
EKPTTANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMITTGMSEPNASA
QKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSPDTKFNQLAVP
ESDQ
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|333924895|ref|NC_015566.1|:347898-349382 Serratia sp. AS12 chromosome, complete genome
ATGAATAACACGATGAATAAACGCACTTTCCGAGGCCGGCGCAGCCTGCTGTCTCTGTGGGTTGTCAGCA
GTCTGATGCTGGTCGGCATGAACGCGCACGCTGACGACAATGATGATAACGGTACTTTGTTTGGCATTTC
GTTGCCCCAGGTGAATGACAGCAATATCGGTTACGGGAAGAGCGCCAGCGGCGCGGTCTCGGACAAGCTG
TTTTATTCCCTGGGCGGTGGCTCGGTGATCTCACAGCCGGCGACACGCGGCAACATGCAACGCCTGGGCA
TGAACCTGGGCTGGAGCTCGGATTTGATGTGCGGCAACTTCGATCTGAAAACGACGATCGGTAATCAGCT
TAATGGTGTCACCGACGGCTTCAAGAACCTGATGGGCAGCGTTATCCAGGGCGCTACTGGAGCGGTGGCC
AGTTTGCCGGCGATGGCTATCCAGCGTGCCAACCCGGGGTTGTATGAAATGCTGACCAACGGAGTGCTGC
AGGGTGGCGTCGCGTTCGACAAGGCGCAGTTGAACTGTCAGAACCTCTCGAAGCGCATGATGGACATGGC
GGATACCGGCGGCTGGAGTCAGGCGGCAGCGATGGAGGAAGCCAAGAGCCTGGTCAATAACGGGGACGCG
GATGCGGTGCGATCGATGAATGCCACGGAGAAAGTGACCGGGCAATCCGGCCAGACCTGGATCGGCGGCC
AGAAGCGAGGTGGCGCCGGTCAGCCGGCCATCAAGCCAACGCACGACCTGGCGGCCGCCGGCTACAACAT
GATGAATGCGTTGCCGGTCACCAGTACCTCTAGTGTATCCGGCAGCAGCTGCACCGGCGGCTCCTGTGCC
AAATATGCCAGCAGCGAAGAAGCGGCCGCTGCAGTGGTGAAGGTGTTGGGGGATTCCTCGCTGCGTACCT
GTAAGGATGCGGCGCAATGTACCAGTGGTGAAGGGAGTGAACAGCCCGGCAGTACCGTGGCCGGCACCGG
TTTTGCGCCGATGCTGGAAGAGGCGACAAAAGCAAATAACGAGCAGTTGGCCAAACTGGTCAACGGGGCA
GAGAAACCCACCACTGCCAACCTGGCCAAGCTCAAGACGGGCAGCCTGGCGGTGACCGCCGGGGTTATCA
AGGCGCTGCAGCGTGACCCGGATAATGCTGCTCTGGTCGGCCGCCTGGCCAGCGAACTGGCGATGGCGGA
CACCATTGAAACCGCCTTCATTATGCGTCGCATGATCACTACCGGGATGTCCGAGCCCAATGCCTCCGCA
CAGAAAGTGGCGATGGAAGAGGGCGATCGGCGTATCGAGGCGCTGGATCGCGAGATCACTGCGCTGAAGA
ATGAAATGGAAATGAAACGCGAGATTTCCCGTAACGCGGTGCTGACCATCATCGATCGCGAGAACAACCG
TGCGGAAACCAACCCGCAGCGTCAATCGGTTGACAGCCCGGACACCAAGTTTAACCAGTTGGCCGTACCG
GAAAGCGACCAGTAA
 Primer design