SecReT4
Protein ID: 333930122
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0277
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]328376..329020 [+]
Producttype IV B pilus protein
Component typeTfc2
UniProt IDG0B2K5
KEGG IDsrr:SerAS9_0277
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 214 a.a.     [Download]
>gi|333930122|ref|YP_004503700.1| type IV B pilus protein [Serratia plymuthica AS9]
MKKTFLASSLAALMLTGCVTQQPLQQRDISPVTPFVTVNRNVQPVSPDAYGQAPEVVRYDRYLLVSTDPA
AVQRDPLSQVIDIRIPASVKPTVADALRYALRQSGYSLCATGPANGVLYRQALPAVQYQLGPMRLRTALQ
VLAGPAWQLEVDDVQRVVCHSLRYGYQLPATQLPPVMEVPGKAILVPVSARPAATVIAPQAVNAVPATGG
WLKK
 
Nucleotide Sequence: 645 bp     [Download]
>gi|333929848|ref|NC_015567.1|:328376-329020 Serratia plymuthica AS9 chromosome, complete genome
ATGAAAAAAACATTTCTCGCCTCTTCCCTGGCAGCACTGATGCTGACCGGGTGCGTTACTCAGCAGCCTC
TGCAGCAGCGTGATATTTCCCCTGTTACGCCGTTTGTCACCGTCAACCGCAATGTTCAGCCGGTCAGCCC
GGATGCCTACGGGCAGGCGCCGGAGGTGGTGCGCTACGACCGTTATTTATTGGTCAGCACTGACCCGGCG
GCCGTTCAGCGTGATCCTCTCTCGCAAGTCATCGATATCCGTATTCCGGCGTCAGTAAAACCGACGGTTG
CTGATGCGTTGCGCTATGCGCTGCGCCAGTCGGGCTATTCCCTGTGCGCGACCGGACCGGCAAACGGCGT
GCTATACCGCCAGGCGTTGCCGGCGGTGCAGTACCAACTGGGGCCGATGCGTTTGCGTACTGCCCTGCAG
GTACTGGCAGGTCCCGCGTGGCAGCTCGAGGTAGACGACGTGCAACGTGTTGTCTGCCACAGCCTGCGTT
ACGGGTATCAGTTGCCGGCGACACAGCTACCGCCGGTGATGGAGGTACCGGGCAAGGCGATTTTAGTACC
GGTTTCAGCACGTCCTGCTGCAACTGTCATTGCACCTCAAGCCGTTAACGCGGTGCCAGCAACCGGTGGG
TGGTTGAAAAAATGA
 Primer design