SecReT4
Protein ID: 333930124
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0279
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]329771..330481 [+]
Productintegrating conjugative element protein
Component typeTfc3
UniProt IDG0B2K7
KEGG IDsrr:SerAS9_0279
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 236 a.a.     [Download]
>gi|333930124|ref|YP_004503702.1| integrating conjugative element protein [Serratia plymuthica AS9]
MKLKYNMVALMLLTPLSQAAQQTAIENSQSTLSQLQQSQANKTAEQGKQWGISGEEYQRYQQLMDGPRGT
QSPGLDPLTALGIEAQSDAERKKYAEQWVKQEFVRTEKELKFQREVDAAWQRLGVLPVNMGNAAGIAHDT
GGRLALFVKAKDCGQCDARLAAVLADNRPVDIYLVDSKGNDSLLRDWARAHHIPIDKVRARQITLNHDGG
RWMKFGNGLMPVVLQQGENGWTLAAF
 
Nucleotide Sequence: 711 bp     [Download]
>gi|333929848|ref|NC_015567.1|:329771-330481 Serratia plymuthica AS9 chromosome, complete genome
ATGAAACTGAAATACAACATGGTCGCGTTGATGCTACTGACCCCGTTATCACAGGCGGCGCAGCAGACGG
CCATCGAGAACAGCCAGTCTACCCTGAGCCAGCTTCAGCAGAGCCAGGCCAATAAGACGGCTGAACAGGG
CAAGCAGTGGGGCATCAGTGGGGAAGAGTACCAGCGATACCAGCAGTTGATGGATGGTCCCCGCGGGACC
CAATCCCCCGGGCTTGATCCATTAACCGCCCTTGGCATTGAGGCTCAGAGCGACGCCGAACGTAAAAAGT
ACGCCGAGCAGTGGGTGAAGCAGGAGTTTGTACGCACTGAGAAAGAACTCAAGTTCCAGCGTGAGGTGGA
TGCGGCCTGGCAGCGCCTCGGTGTGTTGCCGGTCAACATGGGGAACGCTGCGGGTATCGCGCATGACACG
GGCGGGCGATTGGCGCTGTTCGTGAAAGCGAAGGACTGCGGTCAGTGTGATGCTCGACTGGCGGCGGTAC
TGGCAGATAACCGGCCGGTCGACATTTACCTGGTCGACAGCAAGGGCAATGACAGCTTGCTGCGTGACTG
GGCCCGGGCGCATCACATTCCCATCGACAAGGTACGCGCACGTCAAATCACGCTAAATCATGACGGTGGC
CGCTGGATGAAATTTGGCAACGGCCTGATGCCGGTGGTGCTGCAACAAGGGGAAAACGGATGGACACTCG
CCGCGTTCTGA
 Primer design