SecReT4
Protein ID: 333930125
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0280
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]330460..331146 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDG0B2K8
KEGG IDsrr:SerAS9_0280
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 228 a.a.     [Download]
>gi|333930125|ref|YP_004503703.1| lytic transglycosylase catalytic subunit [Serratia plymuthica AS9]
MDTRRVLTRGLLPLFAFLTSVGGGVVHAVTQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIVSVT
RGAGPAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWAA
FEPYTNLNAAAAILRECYDRNPGSWLVAAGCYHHPAGGAPAARYKSIVSGKLARLNGKASAPIRMTSTMP
TALPAQTAALTWIEPRSQ
 
Nucleotide Sequence: 687 bp     [Download]
>gi|333929848|ref|NC_015567.1|:330460-331146 Serratia plymuthica AS9 chromosome, complete genome
ATGGACACTCGCCGCGTTCTGACCCGGGGGCTATTGCCCCTGTTTGCCTTCCTCACTTCTGTGGGGGGCG
GAGTCGTTCATGCTGTTACCCAGCAGGTACCCTCCGGTTATCGGGAGGTGGCGTTGCGTCACGGGGTTCC
TCCTGAGTCCCTGTATTCAGTTGCGTTGGCCGAGACATCGATGGCCCCGAAAAGCATTGTTTCAGTGACC
CGCGGCGCCGGTCCGGCCCCGGATGTGGAGCGTCCCTGGCCCTGGACCATCAATGTTGCCGGTAAAGGGT
ATCGCTATGCCAGCCGCCTGCAAGCCTGGGAAGCCTTGCAGCGTTTTTTGAAAACACATCCTCGCAAGCG
CATTGATGTCGGGATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTCACGTCGACCTGGGCGGCG
TTTGAACCGTACACCAACCTCAACGCCGCCGCGGCCATCCTGCGGGAGTGCTATGACCGCAACCCCGGTA
GCTGGCTGGTTGCCGCCGGGTGTTATCACCATCCTGCCGGCGGAGCGCCCGCTGCCCGGTATAAATCCAT
CGTGAGCGGCAAGCTGGCACGCCTAAACGGCAAGGCATCCGCCCCGATCCGGATGACCAGCACTATGCCC
ACGGCGTTACCGGCACAAACGGCGGCGCTGACCTGGATTGAACCACGGAGCCAATAA
 Primer design