SecReT4
Protein ID: 333930126
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0281
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]331149..331673 [+]
Productintegrating conjugative element protein
Component typeTfc5
UniProt IDG0B2K9
KEGG IDsrr:SerAS9_0281
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 9.2e-49, Aligned region: 25..168
Protein Sequence: 174 a.a.     [Download]
>gi|333930126|ref|YP_004503704.1| integrating conjugative element protein [Serratia plymuthica AS9]
MKKVNFLLFGLSLVTTAALANLNVIADVGGEDASPYFEGVNRQEGAQSSPVVPPAPASPADTEAAVLPVA
TPELTPGDVADRPLQLPGIGALFIVGDDDASRIWLQVNAEQLKSRHAAGLVVNVSNQPALQVLRELALGV
PMAPASGSELARRLQLAHYPVLITDTGLSQQVTP
 
Nucleotide Sequence: 525 bp     [Download]
>gi|333929848|ref|NC_015567.1|:331149-331673 Serratia plymuthica AS9 chromosome, complete genome
ATGAAAAAAGTGAATTTTCTGCTGTTCGGCCTGAGTCTGGTGACCACCGCGGCGCTGGCCAACCTGAATG
TGATTGCCGATGTCGGTGGTGAAGATGCTTCGCCGTATTTTGAAGGTGTCAACCGCCAGGAGGGGGCGCA
ATCGTCTCCGGTCGTGCCGCCGGCGCCGGCATCTCCTGCTGATACCGAGGCGGCAGTGTTGCCCGTGGCA
ACGCCAGAGCTGACACCCGGAGATGTGGCTGACAGACCGCTGCAGTTACCCGGCATTGGCGCGCTGTTTA
TTGTGGGTGATGACGATGCCAGCCGCATCTGGCTGCAGGTGAACGCTGAACAACTCAAATCGCGACATGC
TGCGGGACTTGTTGTGAATGTCAGCAACCAACCTGCACTGCAGGTGCTGCGTGAACTGGCACTGGGTGTG
CCGATGGCGCCCGCATCCGGCAGTGAACTGGCGCGTCGTCTGCAGTTGGCGCATTACCCGGTGCTGATCA
CCGATACCGGGCTGTCACAACAGGTTACGCCATGA
 Primer design