SecReT4
Protein ID: 333930128
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0283
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]332263..334377 [+]
Productconjugative coupling factor TraD
Component typeTfc6
UniProt IDG0B2L1
KEGG IDsrr:SerAS9_0283
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.3e-15, Aligned region: 502..632
TrwB_AAD_bind [PF10412], Evalue: 1.4e-13, Aligned region: 177..225
TrwB_AAD_bind [PF10412], Evalue: 1.4e-13, Aligned region: 500..642
AAA_10 [PF12846], Evalue: 2.9e-10, Aligned region: 188..577
Protein Sequence: 704 a.a.     [Download]
>gi|333930128|ref|YP_004503706.1| conjugative coupling factor TraD [Serratia plymuthica AS9]
MSNRHVMEALLRPAVELNTAIVAGTAAVICFVAPWSVALAPEVSYVTAGSFAVLSAIRARQGMQVIRYRR
NLRRLPRYVMTSAQIPVSRQRLFLGRGFRWQQKHIQRLMDTRRPEVEKYVQPPQLYQMARRLELKTEYTL
PWLSQLLRKDSALNPVRPLPPVGGNPAIHGIEPDELDVSMDLRERVGHSLVLGTTRVGKTRLAELLITQD
IRRGDITIVFDPKGDADLLRRVWAEAHRAGRGDELFIFHLGWPDISARYNAVGRFERVSEVAGRISGQLS
GEGNSAAFREFAWRFVNIVARALVALGQRPDYTLITRYVNNISELYETYAKKVIETRMPALQQQIDNNLK
VLTEEDVPRNMQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLAPNYMDMNDPRPIFDWEQVIRKQGIVYVGLDALSDGVVASAVGNSMFADLVSVAGHIYKHGMH
GGLPTRADGKLPINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTESDIEARIGSTAKAAQVTGNFN
TLIMLRVRENRTAQLLTTQLPEVDVYTKTLVSGHADTADVEKGQDFTSSTQDRVGTVKTPLLMPADVINL
PKGQAFALLEGGQLWKIRMPLPSGDGDDALMPPNLEKIAEEMQRNYRTSESWWSASTVMPDAVIKGGLNV
TSGE
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|333929848|ref|NC_015567.1|:332263-334377 Serratia plymuthica AS9 chromosome, complete genome
ATGAGTAATCGCCACGTGATGGAAGCGTTGCTGCGCCCGGCAGTCGAATTGAATACAGCGATTGTGGCTG
GCACCGCAGCTGTCATTTGTTTTGTTGCTCCCTGGTCGGTAGCGCTGGCACCAGAGGTGAGCTATGTCAC
CGCCGGCAGCTTTGCGGTGTTATCTGCCATACGAGCCCGTCAGGGCATGCAGGTGATCCGCTATCGCCGC
AATCTGCGCCGGCTGCCGCGGTATGTCATGACCAGTGCCCAAATCCCGGTCAGCCGGCAGCGGTTGTTCC
TGGGGCGGGGTTTTCGCTGGCAGCAAAAGCACATCCAGCGGCTGATGGATACCCGTCGTCCAGAGGTTGA
GAAGTATGTTCAGCCGCCGCAGCTGTACCAGATGGCGCGGCGCCTGGAGCTTAAAACCGAATACACCCTA
CCGTGGTTATCCCAGTTGCTGCGCAAAGACTCCGCATTGAACCCGGTCAGGCCGTTGCCACCGGTCGGAG
GGAACCCGGCAATTCATGGTATTGAGCCCGATGAGCTGGATGTTTCGATGGATTTGCGTGAACGCGTGGG
CCACAGCCTGGTACTGGGTACTACCCGTGTGGGTAAAACGCGTCTAGCTGAGTTGCTGATCACCCAGGAT
ATTCGGCGCGGTGACATCACCATCGTGTTTGATCCGAAAGGCGATGCGGACTTGCTGCGGCGTGTCTGGG
CTGAAGCCCACCGTGCCGGCCGTGGGGATGAGCTGTTCATCTTCCATCTGGGTTGGCCGGATATCTCGGC
ACGCTATAACGCCGTCGGTCGCTTTGAACGGGTATCGGAAGTCGCCGGCCGTATCTCCGGGCAGTTGAGT
GGGGAGGGCAACAGTGCGGCATTCCGCGAGTTTGCCTGGCGATTCGTCAACATCGTCGCGCGTGCCCTGG
TCGCGTTGGGGCAGCGACCGGACTACACCCTCATCACCCGCTATGTGAACAACATCAGCGAACTGTATGA
GACCTACGCGAAAAAGGTCATTGAAACGCGTATGCCGGCACTGCAGCAGCAGATAGATAACAACCTGAAA
GTGCTGACGGAGGAGGACGTGCCGCGCAACATGCAGGGACAACCGAACGCGGTCAAAATATTCGCTGTTG
AAATGGCCCTGAGCTCGGAAGCTGGCAAGCAGCTGTACGACCCTATCCTGGATGGCTTGCGCTCAGCCGT
GCGCTATGACCGTACCTATTTCGATAAAATTGTAGCGTCCTTGCTGCCTCTGCTGGAAAAACTCACCACC
GGCAAGACCGCAGAGCTGCTGGCACCGAACTATATGGACATGAATGACCCCCGGCCGATATTTGATTGGG
AGCAGGTCATCCGAAAGCAGGGCATTGTCTACGTAGGGCTGGATGCGCTGTCGGACGGTGTGGTCGCCTC
TGCCGTCGGTAACAGCATGTTTGCTGATCTGGTGTCAGTGGCTGGCCATATCTATAAACACGGCATGCAT
GGCGGGTTGCCGACCCGTGCCGACGGCAAACTGCCGATCAACCTGCACTGCGATGAGTTTAACGAACTGA
TGGGGGACGAATTTATTCCTCTCATCAACAAAGGCGGTGGCGCCGGCATGCAGGTGACGGCTTACACGCA
AACCGAGTCGGACATCGAGGCTCGCATAGGCAGTACCGCCAAGGCTGCCCAGGTGACGGGTAACTTTAAT
ACCCTGATCATGCTGCGCGTGCGAGAGAACCGGACCGCACAGCTACTGACAACACAGCTCCCGGAGGTCG
ATGTCTACACCAAAACCCTGGTGTCGGGGCACGCCGATACGGCCGACGTCGAGAAAGGGCAGGACTTCAC
GTCCAGCACCCAGGATCGCGTTGGTACGGTGAAAACGCCGCTGCTGATGCCGGCGGATGTGATCAACCTG
CCGAAGGGGCAGGCGTTCGCGTTGCTGGAAGGCGGGCAGTTGTGGAAAATTCGGATGCCCTTACCCAGTG
GGGATGGCGATGATGCGTTGATGCCACCTAACCTAGAGAAGATTGCCGAGGAGATGCAGCGCAATTACCG
GACCAGTGAATCCTGGTGGTCAGCCAGCACGGTAATGCCTGATGCGGTCATAAAAGGGGGACTGAATGTC
ACAAGCGGTGAATAA
 Primer design