SecReT4
Protein ID: 333930129
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0284
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]334358..335116 [+]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDG0B2L2
KEGG IDsrr:SerAS9_0284
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.6e-75, Aligned region: 49..249
Protein Sequence: 252 a.a.     [Download]
>gi|333930129|ref|YP_004503707.1| integrating conjugative element membrane protein [Serratia plymuthica AS9]
MSQAVNNQPQQPVQPRKHGVFYNVLWGWPWMLIGMFFASLLVSLVIEYVGMAFFWPELGASHSEAVMHTE
MGYLSSEFTRSLMLSEPSVTVTRWIGQAYQWTFVDSGFLDWIQRAYDSQVHSQNAVARELNNWSGWLAAT
LKEYLVATVYVTVITLVRVTILVLSIPLFILVVLVALTEGLGRRDIRRYGAGYESSFVYHHAKRMVKPAI
YIPCMLYLSWPTAVYPNLLLLPAAILLGIAVTVTTASFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|333929848|ref|NC_015567.1|:334358-335116 Serratia plymuthica AS9 chromosome, complete genome
ATGTCACAAGCGGTGAATAATCAGCCTCAGCAGCCCGTACAACCTCGCAAGCATGGGGTGTTTTACAACG
TACTGTGGGGCTGGCCATGGATGCTGATCGGGATGTTCTTCGCCTCGTTGTTAGTGAGCTTGGTGATTGA
GTATGTCGGGATGGCATTCTTCTGGCCAGAGCTTGGCGCGTCGCACAGTGAAGCGGTGATGCATACCGAA
ATGGGGTATTTGTCATCGGAGTTTACCCGCAGTCTGATGTTGTCTGAGCCGTCAGTCACCGTCACGCGGT
GGATTGGCCAGGCGTATCAGTGGACCTTCGTGGACAGCGGTTTTTTGGACTGGATCCAACGTGCCTATGA
TTCGCAGGTGCACAGCCAGAATGCGGTGGCCCGAGAGCTGAACAATTGGAGTGGCTGGCTGGCCGCCACG
CTCAAGGAGTACCTGGTGGCAACAGTGTATGTCACCGTCATCACCCTGGTGCGGGTGACCATTCTTGTGC
TGTCCATCCCGCTGTTTATCCTGGTGGTCCTGGTTGCGCTGACAGAAGGCCTGGGGCGGCGTGATATCCG
TCGTTATGGCGCCGGCTATGAAAGCAGCTTTGTCTACCATCATGCGAAAAGAATGGTAAAGCCGGCTATC
TATATTCCCTGCATGCTGTATCTGTCCTGGCCAACGGCGGTATATCCCAACCTGCTGCTGTTGCCGGCCG
CTATCCTGCTCGGTATTGCGGTGACGGTAACCACAGCCTCCTTCAAAAAATACCTGTAG
 Primer design