SecReT4
Protein ID: 333930131
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0286
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]335706..336041 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDG0B2L4
KEGG IDsrr:SerAS9_0286
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-30, Aligned region: 25..106
Protein Sequence: 111 a.a.     [Download]
>gi|333930131|ref|YP_004503709.1| hypothetical protein SerAS9_0286 [Serratia plymuthica AS9]
MRIPVVVTRGLGASCLLGLSFLIALPACAAEKDELASAQRMLIQVQAALERARVAAVQADQSERGRFFFD
YARATSDLKTINAGIDRYLEPSRAQPRDGSAVAGNYRRERP
 
Nucleotide Sequence: 336 bp     [Download]
>gi|333929848|ref|NC_015567.1|:335706-336041 Serratia plymuthica AS9 chromosome, complete genome
ATGCGTATCCCCGTAGTCGTCACCCGAGGATTGGGCGCCAGCTGTTTGCTGGGGTTGTCCTTCCTTATCG
CACTGCCTGCCTGTGCTGCTGAAAAAGATGAGTTGGCGTCTGCTCAACGCATGTTGATTCAGGTGCAGGC
AGCACTTGAACGCGCGCGCGTTGCCGCCGTTCAGGCCGACCAGTCCGAGCGTGGTCGTTTCTTTTTCGAC
TATGCCCGTGCCACGTCCGATCTGAAAACTATCAATGCCGGTATTGACCGCTATCTGGAGCCATCGCGCG
CGCAACCGCGTGATGGCAGCGCTGTGGCTGGCAATTACCGTCGGGAGCGTCCCTGA
 Primer design