SecReT4
Protein ID: 333930134
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0289
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]336716..337081 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDG0B2L7
KEGG IDsrr:SerAS9_0289
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.6e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|333930134|ref|YP_004503712.1| hypothetical protein SerAS9_0289 [Serratia plymuthica AS9]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRLKRGKPENYIWQRLEARKRRMGWGDPTLIIDKQGWSLRRSRVVKRST
 
Nucleotide Sequence: 366 bp     [Download]
>gi|333929848|ref|NC_015567.1|:336716-337081 Serratia plymuthica AS9 chromosome, complete genome
ATGCAGACTATCCGATTTTTGCCTGACCGTCTTAACGCTGAGCCTGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGACTGGCGGCGTTGGCCGGGGTGGGACTGGGTCTGCTCGTGTCGTTGCCGTTTTTTCCGCT
TGCCGGTTGGGTCGTGATACCCACCGGCATGCTGGTGACCCCTCTCCTCGTTATCTGGTTTGGTGGCAGC
CGGCTGACGCGCCTCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCGCGTAAACGTC
GCATGGGGTGGGGTGATCCCACCCTGATTATCGACAAACAGGGCTGGTCGTTGCGCCGCAGCCGCGTTGT
TAAGAGGTCAACATGA
 Primer design