SecReT4
Protein ID: 333930135
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0290
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]337078..337749 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDG0B2L8
KEGG IDsrr:SerAS9_0290
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3.3e-90, Aligned region: 5..207
Protein Sequence: 223 a.a.     [Download]
>gi|333930135|ref|YP_004503713.1| hypothetical protein SerAS9_0290 [Serratia plymuthica AS9]
MSHFRHAVKNRDQHILTLRVACGVLVVFLLVASIGWMRAPENLTIHNPPDLRSGSTRAWWEVPPSTVYSF
GFYIFQQLNAWPKNGEVDYPAKINGLSPYLTPSCERFLKADAKKRSESGELAGRTRVVFEIPEHGYNGRY
NQSPVTVKGRDNWVVRLDLVADESFAGEPVKRALTRYPLKVVRAEGDPERNEFGLALDCYDSMPQRLAAA
PAEPAPEKKGVFQ
 
Nucleotide Sequence: 672 bp     [Download]
>gi|333929848|ref|NC_015567.1|:337078-337749 Serratia plymuthica AS9 chromosome, complete genome
ATGAGCCATTTTAGACATGCGGTTAAAAACCGCGACCAGCACATTCTCACATTACGCGTTGCCTGCGGTG
TGCTGGTTGTTTTCCTCCTGGTGGCCAGCATCGGCTGGATGCGGGCGCCGGAGAACCTGACTATTCATAA
CCCCCCCGACCTGCGTAGCGGCTCTACCCGCGCCTGGTGGGAGGTTCCGCCCTCAACAGTCTACAGCTTC
GGCTTTTATATCTTTCAGCAACTCAATGCCTGGCCAAAAAACGGTGAGGTGGATTACCCGGCCAAAATCA
ATGGCCTGTCACCCTACCTGACACCGTCGTGTGAGCGTTTCTTGAAAGCTGACGCCAAAAAGCGCAGCGA
AAGCGGCGAGCTCGCCGGCAGGACGCGTGTGGTGTTTGAAATCCCCGAGCATGGTTACAACGGCCGTTAT
AACCAGAGCCCGGTGACGGTGAAAGGCCGTGATAACTGGGTGGTACGCCTTGATCTGGTGGCGGATGAGT
CCTTTGCCGGCGAACCGGTGAAGCGCGCACTGACACGCTACCCGCTGAAAGTGGTGCGCGCAGAAGGGGA
TCCGGAACGTAATGAGTTCGGTCTGGCCCTGGATTGTTACGACAGCATGCCACAGCGTCTGGCTGCGGCG
CCGGCGGAACCCGCGCCTGAGAAGAAAGGAGTATTCCAATGA
 Primer design