SecReT4
Protein ID: 333930136
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0291
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]337746..338657 [+]
Productintegrating conjugative element protein
Component typeTfc13
UniProt IDG0B2L9
KEGG IDsrr:SerAS9_0291
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 3.5e-114, Aligned region: 11..296
Protein Sequence: 303 a.a.     [Download]
>gi|333930136|ref|YP_004503714.1| integrating conjugative element protein [Serratia plymuthica AS9]
MMKARVLALSLSVLPLAAMFTVPVAQSEELMKWERIPLQIPLAVGKERVLFADKNVRVGFPPALNGKLRV
QSSGGAVYLKADAAFPPTRLQLQDVENGGVILLDVTASDKGSAEPVRIVYSGDVSSISSSNDTATSSAGS
PSAAPGAEDGTQAKRKKIRYNAPLPVVLTRYAAQSLYGPVRTVEAVPGIHPVNPHLPKRITTLYPSEPVA
ITLLGGWGIGSRNVVALKVQNTASRKIILDPRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDG
AFVAEPSGVRKAVKAAKKGANHG
 
Nucleotide Sequence: 912 bp     [Download]
>gi|333929848|ref|NC_015567.1|:337746-338657 Serratia plymuthica AS9 chromosome, complete genome
ATGATGAAAGCACGCGTTCTTGCGCTTTCCCTGAGTGTGCTTCCCCTGGCGGCGATGTTCACCGTACCGG
TAGCCCAGTCGGAAGAGCTGATGAAATGGGAGCGTATCCCGCTGCAAATCCCGCTGGCCGTCGGCAAGGA
GCGGGTGCTGTTTGCCGATAAAAATGTTCGCGTCGGTTTCCCGCCGGCACTGAACGGCAAGCTGCGGGTG
CAAAGCAGTGGCGGGGCTGTTTATCTGAAAGCCGATGCCGCATTTCCGCCAACGCGTCTGCAACTGCAGG
ACGTCGAAAACGGGGGGGTTATTCTCCTCGATGTGACGGCATCGGACAAAGGCTCCGCCGAGCCGGTGCG
TATTGTCTACAGCGGTGATGTGTCGTCGATCAGTAGCAGTAATGATACCGCGACCTCGTCAGCCGGGAGC
CCTTCGGCAGCGCCTGGGGCGGAAGACGGCACCCAGGCGAAGCGTAAAAAAATCAGATACAACGCCCCGC
TGCCGGTGGTGCTGACACGCTATGCGGCACAAAGCCTGTACGGTCCGGTGCGCACGGTTGAGGCGGTGCC
CGGCATTCACCCGGTCAACCCGCACCTGCCGAAACGTATCACCACACTGTACCCGTCAGAGCCGGTGGCC
ATCACCCTGCTGGGCGGCTGGGGTATTGGCAGTCGTAACGTTGTGGCGCTAAAAGTGCAGAACACCGCCA
GTCGCAAAATCATCCTGGATCCGCGGGTACTGCAGGGGCAGTTCGTGACGGCCACCTTCCAGCACCGTTA
TCTGGGGCCGGTGGGTACCCCGGAGGACACTACCACGCTGTACCTGGTCACCGCCGGTCGCCCGGATGGG
GCGTTTGTCGCGGAGCCGTCGGGGGTTCGCAAAGCGGTGAAGGCAGCGAAGAAGGGGGCAAACCATGGCT
GA
 Primer design