SecReT4
Protein ID: 333930137
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0292
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]338650..340146 [+]
Productintegrating conjugative element protein
Component typeTfc14
UniProt IDG0B2M0
KEGG IDsrr:SerAS9_0292
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 498 a.a.     [Download]
>gi|333930137|ref|YP_004503715.1| integrating conjugative element protein [Serratia plymuthica AS9]
MADVKSNMLPKVIVVGVLAAAVVVGLKACSSNKTTEKTQQAHNVLANMSPEELRALGVEGDTPEDTLRTL
VGTLRTTRTQQAELQSNIDKVLKENEALRKRNTNVSGQVNEAVAGFQKQAQQRQQQLQQEQQTLMGKIQT
LTDQLAGNKDKAKSDSDIPLGLGLDGMGAGEGSAAPGQDGLMWVGPKDMKEPDPRNPNSAKDGPQFPTSF
LSYNAITRQKAAYEQQVKGRTNEKGGEENAEPVFTLPENSTLVGSRSMTALLGRVPINGTVTDPYPFKLM
IGKDNLTANGIELPDVEGAIVSGTASGDWTLSCVRGQVNSITFVFADGTVRTLPHPDTNMKANSSNNSGN
SGKDVSTTAGIGWISDDNGIPCIGGERKSNALTYLPTIAALSAASAAGEGISQGQYTTQNNVNGISDTMT
GNAGQAVLGKALSGGMKETADWVRERYGMMFDAVYVPPGQKLAVHITRQLAIDFETKGRKVRYDFSLPGE
DGSTGGLD
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|333929848|ref|NC_015567.1|:338650-340146 Serratia plymuthica AS9 chromosome, complete genome
ATGGCTGATGTGAAATCTAACATGCTGCCGAAAGTGATTGTGGTCGGCGTGCTGGCTGCGGCCGTGGTTG
TTGGGCTGAAAGCCTGCAGCAGCAATAAAACGACGGAGAAAACTCAGCAGGCACATAACGTGCTGGCCAA
TATGTCGCCGGAGGAGTTGCGCGCCCTAGGCGTTGAAGGGGACACGCCGGAAGACACGTTGCGCACCCTG
GTCGGCACCCTGCGTACCACCCGGACCCAACAGGCTGAGCTGCAAAGCAACATCGACAAAGTATTGAAAG
AAAACGAAGCGCTGCGCAAACGCAATACCAATGTCTCCGGCCAGGTCAATGAGGCTGTGGCCGGTTTCCA
GAAACAGGCGCAGCAACGCCAGCAGCAGCTCCAGCAGGAGCAGCAGACGCTGATGGGGAAAATCCAGACG
CTGACCGATCAATTGGCCGGGAACAAAGACAAGGCGAAGAGCGACAGTGATATCCCGCTCGGTCTGGGGC
TGGATGGCATGGGCGCCGGCGAGGGAAGCGCGGCACCTGGCCAGGATGGTTTGATGTGGGTCGGACCGAA
GGACATGAAAGAACCCGATCCGCGCAATCCGAACAGCGCCAAAGACGGCCCGCAGTTCCCGACGTCGTTC
CTGTCTTATAACGCCATCACGCGCCAGAAAGCCGCCTATGAGCAGCAGGTAAAAGGCCGCACCAATGAAA
AAGGGGGGGAGGAGAATGCCGAGCCGGTGTTTACCTTGCCTGAGAACTCCACTCTGGTGGGCAGTCGTTC
CATGACGGCGCTGCTGGGCCGGGTGCCGATCAACGGCACGGTGACCGACCCCTATCCGTTCAAACTGATG
ATTGGTAAAGATAACCTGACGGCGAACGGCATCGAGCTGCCGGACGTGGAAGGGGCGATTGTCTCTGGGA
CCGCCAGTGGCGACTGGACGTTGTCGTGCGTGCGTGGCCAGGTCAACAGCATTACGTTCGTGTTTGCGGA
CGGTACGGTACGCACCTTGCCGCATCCTGACACCAATATGAAGGCAAACAGCAGCAACAATAGCGGCAAC
AGTGGCAAAGACGTCAGCACCACCGCCGGTATCGGCTGGATTTCCGATGACAATGGCATTCCCTGTATCG
GCGGGGAGCGTAAATCCAATGCCTTGACCTACCTGCCGACCATTGCCGCGTTGTCTGCCGCTAGCGCCGC
CGGTGAGGGGATCAGCCAGGGGCAATACACCACGCAAAACAATGTCAATGGCATCAGCGACACCATGACC
GGCAATGCCGGCCAAGCGGTGCTGGGCAAAGCCCTGTCCGGCGGAATGAAAGAGACCGCCGATTGGGTAC
GCGAGCGCTACGGCATGATGTTCGACGCCGTCTACGTCCCTCCGGGCCAGAAACTGGCCGTACACATTAC
CCGCCAACTGGCGATCGATTTTGAGACCAAAGGGCGCAAGGTGCGTTACGACTTTAGCCTGCCAGGCGAA
GACGGCAGCACCGGCGGACTGGATTAA
 Primer design