SecReT4
Protein ID: 333930139
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0294
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]340302..340727 [+]
Productconjugative transfer region lipoprotein
Component typeTfc15
UniProt IDG0B2M2
KEGG IDsrr:SerAS9_0294
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|333930139|ref|YP_004503717.1| conjugative transfer region lipoprotein [Serratia plymuthica AS9]
MRKNLFNRVLATAVMVSIMALVGCSTSKEEMLPPGDSSMLELWQGDDGGGSARNAVAARDSLRRPLTDSE
SQATAADDRSYSRTQESEISQQFPRLPNPDLVMYVFPHLADGNAPVPGYSTVFPFYSQVQYAMPGERTEA
Y
 
Nucleotide Sequence: 426 bp     [Download]
>gi|333929848|ref|NC_015567.1|:340302-340727 Serratia plymuthica AS9 chromosome, complete genome
ATGCGGAAAAACCTATTTAACCGAGTCCTGGCTACCGCTGTCATGGTCAGCATCATGGCATTGGTCGGCT
GCTCGACGTCGAAAGAGGAAATGCTGCCACCGGGCGATAGCTCGATGCTGGAATTGTGGCAGGGTGATGA
CGGCGGTGGTTCGGCACGTAATGCGGTGGCGGCCCGAGACAGTCTGCGCCGGCCGCTCACCGACAGCGAA
AGTCAGGCGACAGCGGCGGACGATCGCAGCTACAGCCGCACCCAGGAAAGCGAAATCAGCCAGCAGTTCC
CGCGGCTACCGAACCCTGACCTGGTGATGTATGTCTTTCCGCATCTGGCGGACGGCAACGCACCGGTGCC
GGGGTACAGCACCGTGTTCCCGTTCTACAGCCAGGTGCAGTATGCGATGCCGGGTGAACGGACGGAGGCC
TACTGA
 Primer design