SecReT4
Protein ID: 333930140
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0295
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]340727..343591 [+]
Productconjugative transfer ATPase
Component typeTfc16
UniProt IDG0B2M3
KEGG IDsrr:SerAS9_0295
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 5.2e-66, Aligned region: 62..331
AAA_10 [PF12846], Evalue: 5.6e-46, Aligned region: 525..865
Protein Sequence: 954 a.a.     [Download]
>gi|333930140|ref|YP_004503718.1| conjugative transfer ATPase [Serratia plymuthica AS9]
MRFSLFDKKRLTRKTPVVPATGDQDTVIATEDGVPLSVDGREPLRRPGKMTVKDEKQVYHANPSIVDYLP
WAEFLDREQCILLDDGVSVGAVFDITPVATEGRTDDRLEQMRDTVEDALQDSFDEHDENPWVVQFFCQDE
NNVEAYIDRLRNYVKPHAQGSAFTEDWLKETERHMRGIARPEGLFKDTLITDQPWRGQQRRTRMVVYRWI
GKGNHVPMPPIAMLNQTCERVTGALAGAGVACVRQNGAQVHDWLLRHFNPNPEWVEKETLYRDAAYFDSR
DTPEGTMPVQNDFAETLLFTPPVSDPDQGVWWFDNQAHCAIPVEKLRRPPELGTITGEMKRGEKKINALM
DLFPEGTMLCMTIVVQPQDTLENDFNKLSKNAVGENTESGRVRQDVAQVKEYLGNRHKLYRAGITFLLRA
GDLTTLNHKRVDLTNVLLGAGLQPVRPEFDVAPLNTYLRALPMCFNPETDKKHWYTRLTWVQHLAGLLPV
TGRETGTGNPGMSFFNRGGDTLTVDPLNKHDRSQNAHMLYFGPTGAGKSATLCATLSQLMAIHRPRLFIA
EAGNSFGLLADYFESQGLSVNKVSIKPGSGVSLPPFSYAHKLVEDALTTLALDENDLPDIDADGDDDDDK
RDYLGEMEISARMMITGGDAKEEHELKRADRAMIREALLMAARQTYDEGRQMLPADLQKALYTLSKDEGS
DIRNEQRRAKAAEMAESLGMFTQAGSFEAELFNREGSLWPEADVTLIDLGHLAREGYEAQMALTMVSLTN
TINNIAERDQYSERDIVFAVDEAHIVTVNPLLAPYMTKIVKMWRKLGAWLWLATQNLKDFPDIAEKMLNM
AEWWVCLTMPPEEVNDIARFKALTEEQKAVLLSASKLSGCYTEGVVLSKKLEALFRAVPPSLYLALGMTE
KEEKAERRALMQEFGCSELEAARKVAQKLDRLRGLAANGEARAA
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|333929848|ref|NC_015567.1|:340727-343591 Serratia plymuthica AS9 chromosome, complete genome
ATGCGATTTTCCCTGTTTGATAAAAAGCGCCTGACGCGCAAGACGCCGGTGGTGCCGGCTACGGGTGACC
AGGACACCGTGATCGCCACTGAGGATGGCGTGCCGCTGTCCGTCGACGGGCGTGAGCCATTACGGCGCCC
GGGTAAGATGACGGTAAAGGATGAGAAACAGGTGTATCACGCCAACCCGTCCATCGTTGATTACCTGCCC
TGGGCGGAGTTTCTCGACCGCGAACAGTGTATTTTGCTCGATGACGGGGTGTCCGTCGGGGCTGTTTTTG
ACATCACGCCGGTAGCCACCGAAGGACGCACGGACGATCGCCTGGAGCAAATGCGCGACACGGTGGAAGA
CGCCCTGCAGGACTCATTTGACGAGCATGACGAAAACCCCTGGGTGGTGCAGTTCTTTTGCCAGGACGAG
AACAACGTCGAGGCGTATATCGACCGCCTGAGAAATTACGTCAAACCCCATGCCCAGGGCAGCGCGTTCA
CAGAAGACTGGCTGAAAGAAACCGAACGTCATATGCGCGGTATCGCTCGTCCGGAAGGCCTGTTTAAGGA
CACGCTGATCACCGATCAGCCATGGCGTGGGCAGCAACGTCGTACCCGCATGGTGGTGTATCGCTGGATT
GGCAAGGGTAATCATGTTCCGATGCCGCCGATCGCCATGCTGAATCAGACCTGTGAGCGGGTGACCGGGG
CGCTCGCCGGCGCCGGCGTTGCCTGCGTGCGCCAGAACGGGGCACAGGTCCATGACTGGCTGCTGCGTCA
TTTTAATCCCAACCCGGAGTGGGTGGAAAAAGAGACCCTGTACCGTGACGCCGCCTATTTTGACAGTCGT
GATACGCCGGAAGGCACCATGCCGGTGCAGAACGATTTTGCCGAGACCCTGCTGTTCACACCGCCCGTGT
CCGATCCGGACCAGGGGGTGTGGTGGTTCGATAACCAGGCGCATTGTGCCATTCCCGTCGAGAAGCTGCG
CCGCCCGCCGGAGCTGGGCACCATCACCGGTGAAATGAAACGCGGCGAGAAGAAAATCAATGCGCTGATG
GATTTGTTCCCGGAGGGAACGATGCTGTGCATGACCATCGTGGTACAACCTCAGGACACGCTGGAGAATG
ATTTCAACAAGCTGTCGAAAAACGCCGTCGGCGAGAATACCGAATCCGGCCGCGTGCGTCAGGACGTGGC
TCAGGTGAAAGAGTACCTGGGGAATCGCCACAAGCTGTACCGTGCCGGCATTACGTTCCTGCTGCGTGCC
GGCGACCTGACCACACTCAACCACAAACGTGTCGATCTGACCAACGTGCTGCTGGGCGCCGGCCTGCAAC
CGGTACGGCCGGAGTTTGATGTGGCGCCGCTCAATACCTACCTGCGGGCGTTACCGATGTGTTTTAACCC
GGAGACCGACAAGAAACACTGGTATACCCGCCTGACCTGGGTACAGCACCTGGCGGGACTGCTGCCGGTG
ACCGGCCGTGAGACCGGGACCGGTAACCCCGGTATGAGCTTCTTCAACCGCGGCGGGGATACGCTGACGG
TTGACCCGCTTAACAAGCATGACCGTAGCCAGAATGCACACATGCTGTATTTTGGCCCGACCGGCGCGGG
GAAATCGGCGACGCTGTGTGCGACCTTATCGCAACTGATGGCGATACACCGGCCACGGTTGTTTATCGCG
GAAGCGGGCAACTCGTTTGGGTTGCTGGCCGATTACTTCGAGAGCCAGGGGCTCAGCGTCAATAAGGTGA
GCATCAAGCCGGGCAGTGGTGTCTCTCTGCCGCCGTTCTCCTATGCGCACAAGCTGGTCGAAGATGCATT
AACGACGTTGGCTCTGGATGAAAATGACCTGCCGGACATCGATGCCGATGGCGACGACGATGATGACAAG
CGCGATTACCTGGGTGAAATGGAAATCTCGGCGCGCATGATGATCACTGGCGGTGATGCGAAGGAAGAGC
ACGAACTGAAGCGTGCCGACCGCGCGATGATCCGTGAAGCCTTGTTGATGGCGGCGCGTCAGACCTATGA
CGAAGGGCGGCAGATGTTGCCGGCAGATCTGCAGAAGGCGTTGTATACCCTATCCAAAGACGAAGGGAGT
GATATCCGTAATGAGCAGCGCCGGGCCAAGGCGGCTGAAATGGCCGAGTCGCTCGGGATGTTTACCCAGG
CCGGCAGCTTCGAGGCGGAGCTGTTTAACCGCGAGGGTAGCCTGTGGCCAGAGGCGGATGTCACCCTGAT
TGACCTGGGGCATCTGGCGCGTGAGGGGTATGAGGCGCAGATGGCGCTGACGATGGTGAGCCTGACCAAC
ACCATCAACAACATTGCCGAACGAGACCAGTACTCGGAGCGGGACATTGTGTTTGCAGTGGATGAAGCCC
ACATTGTGACGGTGAACCCGCTGCTGGCGCCCTACATGACCAAAATCGTCAAGATGTGGCGTAAACTCGG
TGCCTGGCTGTGGCTGGCGACACAGAACTTAAAAGACTTCCCGGACATTGCCGAGAAGATGCTGAATATG
GCGGAGTGGTGGGTCTGTCTGACGATGCCGCCGGAGGAGGTCAACGATATTGCCCGTTTCAAGGCGCTGA
CCGAGGAGCAAAAAGCGGTGCTGCTGTCGGCCAGCAAGCTGTCCGGTTGCTATACCGAGGGAGTGGTGCT
GTCGAAAAAACTCGAGGCGCTGTTCCGTGCGGTACCGCCAAGCCTGTATCTGGCCCTGGGGATGACCGAG
AAAGAAGAGAAGGCCGAGCGCCGCGCGCTGATGCAGGAGTTTGGTTGTAGTGAGCTCGAGGCTGCCCGCA
AGGTGGCGCAAAAGCTTGACCGCCTGCGCGGCCTGGCGGCGAACGGGGAGGCTCGGGCTGCATGA
 Primer design