SecReT4
Protein ID: 333930144
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0299
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]346639..347043 [+]
Productintegrating conjugative element protein
Component typeTfc24
UniProt IDG0B2M7
KEGG IDsrr:SerAS9_0299
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.5e-38, Aligned region: 20..130
Protein Sequence: 134 a.a.     [Download]
>gi|333930144|ref|YP_004503722.1| integrating conjugative element protein [Serratia plymuthica AS9]
MKISTLLTLFPLLMPASVFAGTVLYTDSHHPPSNVDASVSVIYLDGPEQLQAQTFGELSSNPDEAERQAK
AVLQSPQWQAHEQELATVYRAVVRAWELGVTKVPAVVFDDRDVVYGTADIAQAMALRAQSQGGQ
 
Nucleotide Sequence: 405 bp     [Download]
>gi|333929848|ref|NC_015567.1|:346639-347043 Serratia plymuthica AS9 chromosome, complete genome
ATGAAAATCAGCACGTTGCTGACGTTGTTCCCTCTGCTGATGCCGGCGTCGGTGTTTGCCGGCACGGTAC
TCTATACCGATTCCCACCATCCACCGAGTAACGTTGATGCCTCGGTCTCCGTTATTTATCTTGATGGTCC
CGAGCAACTGCAGGCGCAGACGTTTGGAGAGCTGTCGTCGAACCCGGATGAAGCCGAGCGCCAGGCTAAG
GCCGTGCTGCAGTCACCGCAATGGCAGGCTCATGAACAGGAGCTGGCCACGGTCTACCGTGCGGTGGTGC
GTGCCTGGGAACTGGGCGTGACAAAAGTGCCGGCCGTCGTGTTTGACGATAGGGATGTGGTGTATGGCAC
GGCTGATATAGCCCAGGCCATGGCACTACGTGCCCAGTCACAAGGGGGGCAGTAA
 Primer design