SecReT4
Protein ID: 333930145
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0300
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]347045..348052 [+]
Productintegrating conjugative element protein
Component typeTfc23
UniProt IDG0B2M8
KEGG IDsrr:SerAS9_0300
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.8e-95, Aligned region: 43..324
Protein Sequence: 335 a.a.     [Download]
>gi|333930145|ref|YP_004503723.1| integrating conjugative element protein [Serratia plymuthica AS9]
MQRPLLHGMPPEQPRLTLKSLSVAIMLTAASVPAANAALNSAQIVASAVSQACISWRVSGICYWLLCTPF
GCKVRTSVKVTHYIPEAVVSAYNTQGGNPWREMSMVSQAAGGLESSITSGLSGVSAGGGNNELKTPGERK
TNLHFKYADAIGHPATSLIGGSIAGYSCRSAATPFVPYFLSTLDSLAWRTGIPESLYPEALVPGMREVGS
QAAANMWGNVYPRSGFVTQVDDDKAGALVAQRVADIITRSGQPHVYQLLMGQRSEGYWPPGAVTENTGTN
NHKWQRLAPQLSQSCAVFPDGDHPPAADANAAFALWQPYSCCQRRGQRFLSSTDF
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|333929848|ref|NC_015567.1|:347045-348052 Serratia plymuthica AS9 chromosome, complete genome
ATGCAGCGACCCCTTTTGCATGGGATGCCCCCGGAACAACCCCGCCTTACCCTTAAATCCCTCAGTGTGG
CCATTATGTTGACCGCGGCCAGCGTGCCGGCAGCGAACGCTGCGCTCAACAGCGCGCAGATTGTCGCGAG
TGCCGTGTCGCAGGCCTGCATCAGCTGGCGTGTCAGTGGCATTTGTTATTGGCTGCTGTGCACGCCGTTT
GGCTGCAAGGTGCGGACCTCCGTCAAAGTCACCCACTATATCCCGGAAGCCGTGGTGTCAGCGTACAACA
CCCAGGGAGGCAATCCCTGGCGTGAAATGTCGATGGTGAGTCAGGCTGCCGGCGGGCTGGAAAGCAGTAT
CACCAGCGGGCTGAGTGGCGTGTCTGCCGGCGGTGGGAACAACGAGCTGAAAACCCCCGGGGAACGTAAA
ACCAACCTCCACTTCAAGTATGCCGATGCCATTGGTCATCCGGCAACGTCCCTGATTGGCGGCAGCATTG
CCGGCTATTCGTGCCGCAGCGCGGCGACCCCCTTTGTGCCGTATTTCCTCAGCACGCTGGACAGCCTGGC
GTGGCGTACCGGTATTCCCGAGTCCCTCTACCCGGAGGCGTTGGTTCCGGGGATGCGTGAGGTTGGCAGT
CAGGCGGCCGCGAATATGTGGGGCAACGTCTATCCCCGCTCGGGGTTTGTGACCCAGGTCGATGACGACA
AGGCCGGTGCCCTGGTGGCGCAGCGGGTGGCGGACATCATCACCCGTTCTGGTCAACCCCACGTCTATCA
ACTCCTGATGGGCCAGCGCTCTGAGGGGTACTGGCCTCCAGGCGCTGTGACGGAGAACACCGGTACCAAC
AACCACAAGTGGCAACGTCTGGCGCCGCAGCTCAGCCAGTCTTGCGCCGTGTTCCCGGACGGCGACCATC
CGCCGGCAGCGGATGCGAACGCTGCCTTTGCCCTGTGGCAACCCTACAGCTGCTGCCAGCGCCGCGGGCA
GCGTTTCCTCTCCAGCACGGACTTTTGA
 Primer design