SecReT4
Protein ID: 333930146
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0301
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]348063..349547 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDG0B2M9
KEGG IDsrr:SerAS9_0301
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|333930146|ref|YP_004503724.1| integrating conjugative element protein [Serratia plymuthica AS9]
MNNTMNKRTFRGRRSLLSLWVVSSLMLVGMNAHADDNDDNGTLFGISLPQVNDSNIGYGKSASGAVSDKL
FYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVA
SLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADTGGWSQAAAMEEAKSLVNNGDA
DAVRSMNATEKVTGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGSCA
KYASSEEAAAAVVKVLGDSSLRTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKANNEQLAKLVNGA
EKPTTANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMITTGMSEPNASA
QKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSPDTKFNQLAVP
ESDQ
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|333929848|ref|NC_015567.1|:348063-349547 Serratia plymuthica AS9 chromosome, complete genome
ATGAATAACACGATGAATAAACGCACTTTCCGAGGCCGGCGCAGCCTGCTGTCTCTGTGGGTTGTCAGCA
GTCTGATGCTGGTCGGCATGAACGCGCACGCTGACGACAATGATGATAACGGTACTTTGTTTGGCATTTC
GTTGCCCCAGGTGAATGACAGCAATATCGGTTACGGGAAGAGCGCCAGCGGCGCGGTCTCGGACAAGCTG
TTTTATTCCCTGGGCGGTGGCTCGGTGATCTCACAGCCGGCGACACGCGGCAACATGCAACGCCTGGGCA
TGAACCTGGGCTGGAGCTCGGATTTGATGTGCGGCAACTTCGATCTGAAAACGACGATCGGTAATCAGCT
TAATGGTGTCACCGACGGCTTCAAGAACCTGATGGGCAGCGTTATCCAGGGCGCTACTGGAGCGGTGGCC
AGTTTGCCGGCGATGGCTATCCAGCGTGCCAACCCGGGGTTGTATGAAATGCTGACCAACGGAGTGCTGC
AGGGTGGCGTCGCGTTCGACAAGGCGCAGTTGAACTGTCAGAACCTCTCGAAGCGCATGATGGACATGGC
GGATACCGGCGGCTGGAGTCAGGCGGCAGCGATGGAGGAAGCCAAGAGCCTGGTCAATAACGGGGACGCG
GATGCGGTGCGATCGATGAATGCCACGGAGAAAGTGACCGGGCAATCCGGCCAGACCTGGATCGGCGGCC
AGAAGCGAGGTGGCGCCGGTCAGCCGGCCATCAAGCCAACGCACGACCTGGCGGCCGCCGGCTACAACAT
GATGAATGCGTTGCCGGTCACCAGTACCTCTAGTGTATCCGGCAGCAGCTGCACCGGCGGCTCCTGTGCC
AAATATGCCAGCAGCGAAGAAGCGGCCGCTGCAGTGGTGAAGGTGTTGGGGGATTCCTCGCTGCGTACCT
GTAAGGATGCGGCGCAATGTACCAGTGGTGAAGGGAGTGAACAGCCCGGCAGTACCGTGGCCGGCACCGG
TTTTGCGCCGATGCTGGAAGAGGCGACAAAAGCAAATAACGAGCAGTTGGCCAAACTGGTCAACGGGGCA
GAGAAACCCACCACTGCCAACCTGGCCAAGCTCAAGACGGGCAGCCTGGCGGTGACCGCCGGGGTTATCA
AGGCGCTGCAGCGTGACCCGGATAATGCTGCTCTGGTCGGCCGCCTGGCCAGCGAACTGGCGATGGCGGA
CACCATTGAAACCGCCTTCATTATGCGTCGCATGATCACTACCGGGATGTCCGAGCCCAATGCCTCCGCA
CAGAAAGTGGCGATGGAAGAGGGCGATCGGCGTATCGAGGCGCTGGATCGCGAGATCACTGCGCTGAAGA
ATGAAATGGAAATGAAACGCGAGATTTCCCGTAACGCGGTGCTGACCATCATCGATCGCGAGAACAACCG
TGCGGAAACCAACCCGCAGCGTCAATCGGTTGACAGCCCGGACACCAAGTTTAACCAGTTGGCCGTACCG
GAAAGCGACCAGTAA
 Primer design