SecReT4
Protein ID: 333930148
T4SS name [ID]Tfc [678]
Gene symbol-
Locus tagSerAS9_0303
StrainSerratia plymuthica AS9
Repliconchromosome [GenBank: NC_015567] [Browse all T4SS(s) in this replicon]
Location [Strand]349933..351450 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDG0B2N1
KEGG IDsrr:SerAS9_0303
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.3e-123, Aligned region: 8..487
Protein Sequence: 505 a.a.     [Download]
>gi|333930148|ref|YP_004503726.1| hypothetical protein SerAS9_0303 [Serratia plymuthica AS9]
MMTNSYLEYFLTLLGWLINNGLWELLVSTGLFVLPLLFKVAAIWLKVREEGEDEGNKGMLSLPRIENLLY
GAFFVMLACCLPLMNVSLDTIKYDSSRAATCGTWTPKKPDETGYANIMSSMNGQTAKVPVWWLVVHKLSK
GITSAAVATIPCRPDLRQVRFEVQHSRVNNPALAKELQDFTNDCYALALYTWQNRDQGQTTDKTTLRDIE
WLGSKTFLNGGYYNNLQSKTPRASFPWNEGRDSGRPNTGRGGYPTCSEWWPAGDTGLEARVVKQVDPGVM
LRMSAALKMMGQSDADYKEAVVRRLVSPDNLTVSQGGRAYAGYGGNADFTLDNSVNRIASMGGTALGSLA
AYPAFDAMRQALPMVQAVLLMAVYIMVPLILAFAAYEYKTVITVTFVVFALNFLTFWWELARWLDSWLLE
ALYGSDTHSRWNVAGFQNSSDDLIMNLVMGCMFLVLPAVWLAAFSWAGVRIGELSRMVTDGTSKSQQTGG
IVGDAAVSKVASGGK
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|333929848|ref|NC_015567.1|:349933-351450 Serratia plymuthica AS9 chromosome, complete genome
ATGATGACCAACAGCTATCTGGAGTATTTCCTGACGCTGCTCGGCTGGCTGATTAACAACGGCCTGTGGG
AGCTGCTGGTCAGTACGGGGCTGTTTGTGCTGCCGCTGCTGTTCAAGGTGGCGGCCATCTGGCTGAAGGT
CCGGGAGGAAGGTGAGGATGAGGGCAACAAAGGGATGTTGTCCCTGCCGCGCATCGAGAACCTGCTCTAC
GGCGCGTTTTTTGTGATGCTTGCCTGCTGCCTGCCGCTAATGAATGTCAGTCTGGATACCATCAAATATG
ACAGCAGCCGGGCAGCGACCTGCGGTACCTGGACACCCAAAAAACCGGATGAAACGGGTTACGCCAACAT
CATGTCGAGCATGAACGGCCAGACGGCGAAGGTGCCGGTGTGGTGGTTGGTGGTGCATAAGCTGTCGAAG
GGGATCACGTCGGCGGCAGTGGCCACTATTCCGTGCCGGCCGGATCTGCGGCAGGTCCGTTTTGAGGTCC
AGCACAGTCGGGTCAACAACCCAGCACTGGCAAAGGAGCTGCAGGACTTCACTAACGACTGCTACGCGCT
GGCGCTGTATACCTGGCAGAACCGCGACCAGGGGCAAACGACCGACAAAACCACGTTGCGTGATATCGAG
TGGCTGGGGTCGAAAACCTTCCTGAATGGCGGCTACTACAACAATCTGCAGTCGAAAACGCCGCGCGCCA
GTTTCCCGTGGAATGAAGGGCGGGACAGCGGTCGGCCAAACACCGGACGGGGTGGGTACCCGACCTGCAG
CGAGTGGTGGCCAGCCGGCGATACGGGCCTGGAGGCTAGGGTAGTGAAGCAGGTCGACCCGGGCGTGATG
CTGCGGATGTCCGCTGCGCTGAAGATGATGGGACAATCTGACGCGGACTATAAAGAAGCGGTGGTGCGTC
GTCTGGTCAGCCCGGATAACCTGACCGTCTCCCAGGGCGGACGGGCGTATGCCGGCTATGGCGGTAACGC
GGACTTTACCCTGGACAACTCGGTTAACCGTATTGCCTCGATGGGCGGGACCGCACTGGGGAGCCTGGCG
GCGTATCCGGCTTTTGATGCGATGCGGCAGGCGCTACCGATGGTGCAGGCGGTACTGTTGATGGCGGTGT
ACATCATGGTACCGCTTATCCTGGCATTCGCAGCTTACGAGTATAAGACGGTGATCACCGTGACGTTCGT
GGTGTTCGCGCTGAACTTTTTGACCTTCTGGTGGGAGCTGGCGCGCTGGCTGGACAGTTGGCTGCTGGAA
GCGCTTTACGGCTCGGATACGCACAGCCGATGGAACGTGGCCGGTTTTCAGAACAGTTCTGATGACCTCA
TTATGAATTTGGTGATGGGGTGTATGTTTCTGGTACTGCCAGCTGTATGGCTTGCAGCATTTTCATGGGC
AGGTGTTCGAATTGGTGAACTTTCCCGCATGGTCACTGATGGAACATCTAAGTCTCAACAAACAGGCGGG
ATTGTCGGTGACGCCGCTGTTTCAAAAGTTGCTTCAGGAGGTAAATAG
 Primer design