SecReT4
Protein ID: 333983698
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_1998
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2196236..2196805 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDG0A579
KEGG IDmmt:Metme_1998
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|333983698|ref|YP_004512908.1| unnamed protein product [Methylomonas methanica MC09]
MNPNPQHPAGLLILSILWITIAGCAPIKPEQTQFVSAQDNQASRLGTNQVLRAATNNKLSANVSRSQPKQ
STPTIQTGRYSTLAATPTPAQRDPLAVIIDVTIPETCVSIEQAIRFLLRRSGYELDTALSVDIIELMAKP
LPAVHRQLGPMPLSDALTLLVTPSFVLQDDPIKRLLRFVPIDGNRGGRL
 
Nucleotide Sequence: 570 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2196236-2196805 Methylomonas methanica MC09 chromosome, complete genome
ATGAATCCAAACCCTCAGCATCCTGCTGGTTTGCTAATACTGTCCATCCTCTGGATAACCATCGCCGGAT
GCGCACCGATAAAACCTGAACAGACCCAATTTGTCAGTGCTCAAGACAACCAGGCCAGCCGGCTCGGCAC
AAACCAAGTGCTTCGCGCTGCTACCAATAACAAATTGTCAGCAAATGTATCAAGAAGTCAGCCAAAACAA
TCAACACCAACCATCCAAACCGGTCGCTACAGCACTTTGGCGGCAACACCCACGCCGGCGCAACGGGATC
CGCTAGCGGTGATAATCGATGTGACAATTCCGGAAACGTGCGTCAGCATCGAACAAGCCATTCGCTTCCT
ATTGCGGCGTAGCGGTTATGAATTAGACACTGCTCTGTCAGTAGATATCATCGAACTCATGGCCAAGCCG
CTACCGGCCGTGCATCGACAACTCGGCCCGATGCCCTTAAGCGATGCGCTGACGTTGTTGGTGACGCCGA
GTTTTGTTCTGCAGGACGATCCCATCAAACGATTGCTACGCTTTGTCCCTATTGACGGAAATCGGGGAGG
GCGGTTATGA
 Primer design