SecReT4
Protein ID: 333983700
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2000
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2197607..2198383 [+]
Productintegrating conjugative element protein
Component typeTfc3
UniProt IDG0A581
KEGG IDmmt:Metme_2000
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 258 a.a.     [Download]
>gi|333983700|ref|YP_004512910.1| unnamed protein product [Methylomonas methanica MC09]
MLGKMSPKRQRHVLISLLLLIGLQLPAQAKESQAQPLTYTESKAQSVEEETRLRQHWSLSIDEWRRYKSL
MKGIRGSISPPNISPIEVLGTHARNDQERRRYAEIWARMRHEDAERILAFQQAYAEAFQRLYPNELLVDL
SRLKSSSQPVSASGSRLLVFLKIKQCQACESLVQRLLQQPVFNTQPIDLYFVDTQPQRDDALIQQWAKQQ
HLDSARIKQGLLTLNHDQGNYFKVSQQLVGTMPQVFKLTGQTLEALRL
 
Nucleotide Sequence: 777 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2197607-2198383 Methylomonas methanica MC09 chromosome, complete genome
ATGCTCGGCAAGATGAGCCCTAAGCGTCAACGTCACGTTTTGATTTCTCTATTGCTACTAATCGGGCTGC
AACTGCCGGCGCAGGCAAAGGAGTCCCAGGCTCAGCCATTGACTTACACCGAATCGAAAGCCCAGTCTGT
TGAAGAGGAAACACGCCTCCGCCAACACTGGTCATTATCGATCGACGAATGGCGCCGCTATAAAAGCCTG
ATGAAAGGCATTCGCGGCAGCATCAGTCCGCCGAATATTTCCCCGATCGAAGTGTTGGGCACCCATGCCC
GCAACGATCAGGAACGCCGGCGCTATGCCGAAATCTGGGCCAGAATGCGCCATGAAGATGCCGAACGTAT
TCTGGCTTTTCAACAGGCTTATGCCGAAGCCTTTCAAAGATTGTATCCCAACGAATTGCTCGTTGATTTG
AGCCGATTAAAATCATCTTCCCAACCGGTCTCCGCCTCGGGTAGCCGCTTATTAGTGTTCTTAAAAATCA
AACAGTGCCAAGCGTGTGAAAGCCTGGTGCAGCGTCTATTACAGCAGCCGGTGTTCAACACCCAGCCAAT
CGATTTGTACTTTGTCGATACCCAACCGCAACGCGACGATGCCTTGATTCAGCAGTGGGCTAAACAACAG
CATCTCGACAGCGCCCGTATAAAACAGGGCTTGTTGACATTGAATCATGATCAGGGCAATTATTTTAAAG
TCAGCCAGCAACTGGTAGGCACGATGCCACAGGTCTTCAAACTGACCGGCCAAACGTTGGAAGCTCTGCG
ATTATAA
 Primer design