SecReT4
Protein ID: 333983701
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2001
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2198384..2198950 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDG0A582
KEGG IDmmt:Metme_2001
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 188 a.a.     [Download]
>gi|333983701|ref|YP_004512911.1| unnamed protein product [Methylomonas methanica MC09]
MAVFKSIGCNRFGVVIATLLCHGIPTSWAKDSIPANYRHIAAEHRLPADVLYSVAITESGQKLRSGKLRP
WPWTLNVAGKALRYPTRLAAWRGLTEYLQQGVDLIDIGIMQVNWRYHREQLGSPWQALEPFHNTRTGARI
LKREHQKTGTWKTAIGHYHSPGSKPKQQERAQHYTQRVVKRMAQLRSE
 
Nucleotide Sequence: 567 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2198384-2198950 Methylomonas methanica MC09 chromosome, complete genome
ATGGCTGTCTTCAAATCTATAGGCTGCAATCGGTTTGGCGTCGTAATCGCAACCTTGCTTTGTCACGGAA
TTCCCACAAGCTGGGCCAAGGATAGCATCCCGGCTAATTATCGGCACATCGCCGCTGAACACCGGCTGCC
GGCCGATGTCTTGTATAGCGTCGCCATCACCGAAAGTGGCCAAAAGCTGCGTAGCGGCAAGTTGAGACCC
TGGCCGTGGACATTGAATGTGGCCGGCAAAGCGCTGCGTTATCCAACTCGGCTGGCTGCCTGGCGAGGTC
TGACGGAATATCTGCAACAAGGTGTCGATTTAATCGACATCGGCATCATGCAAGTTAATTGGCGTTATCA
CCGGGAACAATTAGGTTCGCCCTGGCAAGCACTGGAACCCTTTCACAATACCCGTACCGGCGCCCGGATA
CTCAAACGCGAACACCAAAAAACCGGCACCTGGAAAACGGCCATTGGTCATTATCATTCACCGGGTAGCA
AACCCAAGCAGCAAGAACGTGCCCAACACTATACGCAACGGGTAGTCAAACGCATGGCACAGTTACGAAG
TGAATAA
 Primer design