SecReT4
Protein ID: 333983712
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2013
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2208606..2209097 [+]
Productintegrating conjugative element protein
Component typeTfc5
UniProt IDG0A593
KEGG IDmmt:Metme_2013
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.4e-36, Aligned region: 45..161
Protein Sequence: 163 a.a.     [Download]
>gi|333983712|ref|YP_004512922.1| unnamed protein product [Methylomonas methanica MC09]
MRYQLTVCGVLLISSPLLSMAEPVVLYDSGRTTRLPIQPQTLHLQTPVTANFDVQIDTLPIKTPSLSPGN
VVSRRIDRLYLDRPVFLVGADPLSMHWLVLHQAQLKQLHAIGLAVNVETQAQLQQLRKTAGGLEIHPLAG
DAMAAQLALQHYPVLITASRIEQ
 
Nucleotide Sequence: 492 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2208606-2209097 Methylomonas methanica MC09 chromosome, complete genome
ATGCGGTATCAGCTGACCGTCTGTGGTGTTCTATTAATCAGTTCGCCTTTGCTGAGTATGGCAGAACCGG
TGGTGCTTTATGACAGCGGCCGCACCACGCGGTTGCCGATTCAGCCGCAGACACTGCATCTGCAAACACC
CGTCACCGCTAACTTTGATGTACAAATCGATACTTTGCCGATCAAAACCCCGTCGTTGTCGCCGGGTAAT
GTGGTTTCCCGCCGTATTGATCGGCTGTATCTGGATCGACCGGTGTTTTTGGTCGGTGCTGATCCCTTGT
CCATGCACTGGTTAGTGTTGCATCAAGCTCAACTCAAGCAGCTTCACGCCATCGGTCTGGCGGTCAATGT
CGAAACCCAGGCGCAATTACAACAATTGCGAAAAACCGCAGGTGGCTTGGAGATCCATCCGCTGGCCGGC
GATGCCATGGCCGCGCAATTGGCCCTGCAACATTACCCGGTGTTGATCACGGCGTCGCGGATCGAACAAT
GA
 Primer design