SecReT4
Protein ID: 333983713
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2014
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2209094..2211148 [+]
Productconjugative coupling factor TraD
Component typeTfc6
UniProt IDG0A594
KEGG IDmmt:Metme_2014
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3.2e-13, Aligned region: 179..227
TrwB_AAD_bind [PF10412], Evalue: 3.2e-13, Aligned region: 506..642
TraG-D_C [PF12696], Evalue: 1.3e-12, Aligned region: 505..632
AAA_10 [PF12846], Evalue: 2e-10, Aligned region: 189..578
DUF87 [PF01935], Evalue: 2.1e-05, Aligned region: 176..227
Protein Sequence: 684 a.a.     [Download]
>gi|333983713|ref|YP_004512923.1| unnamed protein product [Methylomonas methanica MC09]
MKSQYPVEALLRPPVELWSAVCAFACALLAGLAPWAIMMTPSVGYATAGLLTLLGLARTRQALFVLRYQR
NMRKLPRYEIAAQDIPVSRQRLFLGKGFLWQQKHTQRLRDTLHPKVRRYIEPSFAYQLARRLERRWESSP
TLQPLTKLMQSPAWWNPVAPLPPVGGKPQIHAVELEEQPVSMDLRERVGHTLVLGTTRVGKTRLAELLIT
QDIARGDTVIVFDPKGDADLMKRMVAEAKRAGRSRHLYLFHLGYPEISSRYNAIGNFSRITEVATRLTNP
LPSTGNSAAFREFAWRFTNMIAVALVKMGKRPDYKLITRYITHIEPLLTEYYRQWLPDVAPPDWEQQVQR
IAASINERDLPFALKGRSPEVIALVRYVKDNGFYDAVADGLRSAFEYDKTYFDKIVASLLPLMEKLITGK
TAALISPDYTDIADTRPIIDWRQIIRRQGIVYVGLDALSDMAVASAVGNSMFADLVSVSGEIYKHGTDHG
LPDAVKTHELPTISLHADEFNELIGDEFIPLLNKAGGSGFQVTAYTQTWSDVEARIGNKAKAGQVAGNFN
TLIMLRVKELATAEMLTNQIDTCNISTLMEVSGVNDSADPNSPIDFTSQNQDRISVTEMPMISPATVMAL
PKGQAFALLEGGNLWKIRIPLPTKANDALLPKNLQEVAHEMQRRYLTNDHWWAG
 
Nucleotide Sequence: 2055 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2209094-2211148 Methylomonas methanica MC09 chromosome, complete genome
ATGAAGTCCCAGTATCCGGTCGAAGCCTTGCTGCGGCCGCCGGTCGAACTGTGGTCGGCGGTTTGTGCCT
TCGCTTGTGCGTTGCTGGCCGGCCTGGCGCCGTGGGCTATCATGATGACGCCATCGGTGGGTTATGCCAC
GGCTGGCTTATTGACGCTGCTCGGTTTGGCTAGAACCCGGCAAGCGTTATTCGTCTTGCGCTATCAACGC
AACATGCGCAAGCTGCCACGTTATGAAATCGCAGCCCAAGACATTCCGGTCAGCCGCCAGCGTTTGTTTT
TGGGTAAAGGCTTTTTGTGGCAGCAAAAACACACCCAACGGTTGCGCGATACCTTGCATCCTAAGGTGCG
GCGCTATATCGAACCGTCCTTTGCCTATCAACTGGCCCGGCGTTTGGAGCGCCGCTGGGAATCATCGCCA
ACGTTGCAGCCGTTGACCAAACTGATGCAAAGCCCAGCCTGGTGGAACCCGGTCGCGCCGTTACCGCCGG
TCGGCGGCAAACCGCAGATTCATGCGGTGGAACTCGAAGAACAGCCGGTCAGTATGGATTTGCGCGAACG
GGTCGGGCATACCCTGGTGCTGGGCACTACCCGGGTCGGCAAAACCCGGCTGGCCGAACTCTTGATCACG
CAGGATATCGCCCGCGGCGATACCGTGATCGTGTTCGATCCGAAAGGCGATGCCGATCTGATGAAACGCA
TGGTCGCAGAAGCCAAACGCGCCGGTCGCAGTCGGCATCTGTATCTCTTCCATCTGGGCTATCCGGAGAT
TTCCAGCCGCTATAACGCCATCGGCAATTTCTCCCGCATCACCGAAGTCGCCACCCGCTTGACCAACCCC
TTGCCCAGCACTGGCAATTCGGCGGCGTTCCGTGAATTCGCCTGGCGCTTTACCAATATGATCGCCGTGG
CGCTGGTCAAAATGGGCAAACGCCCGGATTATAAATTGATCACCCGCTACATCACCCATATCGAGCCACT
GTTGACCGAATACTACCGGCAATGGCTGCCCGACGTGGCGCCGCCGGACTGGGAACAACAGGTACAGCGC
ATAGCCGCTTCCATCAACGAACGCGATTTACCCTTTGCGCTAAAAGGCCGATCGCCGGAAGTGATTGCCC
TGGTACGCTATGTCAAAGACAATGGCTTTTACGATGCCGTCGCCGATGGCCTGCGGTCGGCGTTCGAATA
CGACAAGACCTATTTCGATAAAATCGTCGCATCCTTATTGCCGTTGATGGAAAAACTGATTACCGGCAAA
ACCGCGGCGCTGATCTCGCCGGACTACACCGACATCGCCGACACTCGGCCCATCATCGACTGGCGGCAAA
TCATTCGCCGTCAAGGCATCGTCTATGTCGGGCTGGATGCCTTATCGGATATGGCGGTAGCATCCGCAGT
CGGCAATTCCATGTTTGCCGATCTGGTCTCCGTTTCCGGCGAAATCTACAAACACGGCACCGACCACGGT
CTGCCGGATGCGGTAAAAACCCATGAGCTGCCGACGATTTCCTTGCATGCCGACGAATTCAACGAATTGA
TCGGCGACGAGTTTATTCCCTTGCTCAACAAGGCCGGCGGCTCGGGGTTTCAAGTCACGGCCTATACCCA
AACCTGGTCGGATGTGGAAGCCCGCATCGGCAACAAGGCCAAAGCCGGGCAGGTGGCCGGCAACTTCAAT
ACCCTGATCATGCTGCGGGTCAAAGAACTGGCCACCGCCGAAATGCTCACCAACCAAATCGACACCTGTA
ACATCAGCACGCTGATGGAAGTATCCGGCGTCAACGATTCGGCCGATCCCAATTCCCCCATCGATTTTAC
CTCGCAAAACCAGGACCGCATTTCCGTCACCGAAATGCCGATGATTTCACCGGCCACCGTGATGGCCTTA
CCCAAAGGCCAGGCCTTCGCCTTGCTGGAAGGCGGCAATCTGTGGAAAATTCGCATCCCGTTGCCAACTA
AAGCCAACGATGCGCTGTTGCCGAAAAACCTGCAGGAGGTGGCCCATGAAATGCAGCGCCGCTATCTGAC
CAACGACCACTGGTGGGCAGGCTGA
 Primer design