SecReT4
Protein ID: 333983719
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2021
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2218175..2218465 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDG0A5A0
KEGG IDmmt:Metme_2021
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.5e-18, Aligned region: 20..94
Protein Sequence: 96 a.a.     [Download]
>gi|333983719|ref|YP_004512929.1| unnamed protein product [Methylomonas methanica MC09]
MLCNKRLLLILLCLPWPVLADLDGERTALAKLMHELDGLKPLIAEAQGQADQSGRLQFQYDWLRLDIERI
KLGIQEHLTAPRQARSFPPLKGDYRR
 
Nucleotide Sequence: 291 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2218175-2218465 Methylomonas methanica MC09 chromosome, complete genome
ATGCTTTGCAATAAGCGGCTTTTGCTAATTCTACTGTGTTTGCCATGGCCGGTGTTGGCCGATTTAGATG
GAGAGCGGACAGCTTTGGCCAAGCTCATGCATGAGCTGGATGGTTTGAAACCGCTCATTGCTGAAGCGCA
GGGTCAAGCGGATCAATCGGGTCGCTTGCAATTTCAATACGATTGGCTGCGGCTGGATATTGAACGCATC
AAGCTGGGTATACAAGAGCACCTGACCGCACCTCGGCAGGCCCGCAGTTTTCCGCCGCTGAAAGGCGATT
ACCGACGTTGA
 Primer design