SecReT4
Protein ID: 333983721
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2023
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2218736..2219095 [+]
Productintegrating conjugative element membrane protein
Component typeTfc10
UniProt IDG0A5A2
KEGG IDmmt:Metme_2023
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 2.8e-25, Aligned region: 31..118
Protein Sequence: 119 a.a.     [Download]
>gi|333983721|ref|YP_004512931.1| unnamed protein product [Methylomonas methanica MC09]
MLKRLRHTLFSQSLALAAGLTLLSGNLYAALPTAVAPSNAPKAGDWLTLIKGYAKDAGLVIGLVLAVVAF
LWIAWITISKFNEARTGRAEWGEVGLTAVVAAGVMIFISYLLTEASKVI
 
Nucleotide Sequence: 360 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2218736-2219095 Methylomonas methanica MC09 chromosome, complete genome
ATGTTAAAACGCTTACGACACACGTTGTTTTCTCAATCTCTGGCGCTAGCGGCCGGTTTGACCTTACTCA
GCGGTAATCTGTATGCCGCATTGCCAACCGCGGTGGCGCCCAGTAATGCCCCGAAAGCCGGCGACTGGTT
GACCTTGATTAAAGGTTATGCCAAAGATGCCGGTTTGGTGATCGGGTTGGTATTGGCGGTGGTGGCTTTT
TTGTGGATTGCCTGGATCACAATCTCTAAATTCAACGAAGCCCGCACCGGCAGAGCCGAATGGGGCGAGG
TGGGTTTGACCGCCGTGGTGGCGGCCGGCGTAATGATCTTCATCAGTTATCTGCTCACCGAGGCGTCTAA
GGTCATTTGA
 Primer design