SecReT4
Protein ID: 333983722
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2024
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2219098..2219475 [+]
Productconjugative transfer region protein
Component typeTfc11
UniProt IDG0A5A3
KEGG IDmmt:Metme_2024
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.5e-35, Aligned region: 6..118
Protein Sequence: 125 a.a.     [Download]
>gi|333983722|ref|YP_004512932.1| unnamed protein product [Methylomonas methanica MC09]
MDDSGETLADRLNQEPVIFRGSTHSELGFILLLATLFWLPVSLLIAACLGAPAMGLGMAMVGVLVTIVFG
STWFQRIKRGRPDYYYQHRLMIGLHRLGLRKSRLILSSGVWDLGRTVSSSLIRTM
 
Nucleotide Sequence: 378 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2219098-2219475 Methylomonas methanica MC09 chromosome, complete genome
ATGGACGATTCCGGCGAAACTTTGGCTGATCGCCTCAATCAGGAGCCGGTCATCTTCAGAGGCAGCACAC
ATTCCGAGTTAGGGTTTATTTTGCTGTTGGCCACGCTGTTCTGGTTGCCGGTCAGTCTACTGATTGCCGC
CTGCTTGGGTGCGCCGGCCATGGGCCTGGGCATGGCAATGGTCGGCGTGTTGGTGACGATCGTATTCGGT
TCGACCTGGTTTCAACGTATCAAGCGTGGCCGGCCGGATTATTACTACCAGCATCGCTTGATGATTGGCC
TGCATCGCCTCGGGCTGCGTAAATCCCGGCTGATTCTGAGCAGTGGTGTTTGGGATTTGGGGCGTACGGT
CTCTTCATCCCTTATCAGAACGATGTGA
 Primer design