SecReT4
Protein ID: 333983723
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2025
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2219475..2220119 [+]
Productintegrating conjugative element protein
Component typeTfc12
UniProt IDG0A5A4
KEGG IDmmt:Metme_2025
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.6e-73, Aligned region: 10..203
Protein Sequence: 214 a.a.     [Download]
>gi|333983723|ref|YP_004512933.1| unnamed protein product [Methylomonas methanica MC09]
MRYQDVNSRLEAHIHTLRTVIAGLMVLLLLLGYAWHAARSDIRIHIPPDLRSGAVVKADDIAPAHVYAFA
AYIFQQLNHWDRDGETDYGQQIFRMAAYLTPDFREYLSNDLAIRGKRGELAGRVRSIQPVAGRGYEERRV
ELIDPHTWLVWLDFTIQETVRGMDVKQVHIRYPLTVVRYDVDPELNPWGLALSGFAGDGPTRIQAHEQTA
AADE
 
Nucleotide Sequence: 645 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2219475-2220119 Methylomonas methanica MC09 chromosome, complete genome
ATGCGCTATCAAGATGTGAATAGCCGGCTAGAGGCGCATATCCATACCCTGCGTACCGTGATTGCCGGAT
TGATGGTGCTGTTATTGCTGCTGGGCTATGCCTGGCATGCCGCTCGCAGCGATATCCGGATTCACATTCC
ACCGGATCTGCGCTCGGGTGCGGTGGTCAAAGCCGATGATATCGCTCCGGCCCATGTTTATGCCTTTGCA
GCGTACATTTTTCAGCAGCTCAATCACTGGGATCGCGATGGCGAAACCGATTACGGCCAACAGATTTTCC
GCATGGCGGCGTATTTAACTCCGGATTTTCGTGAATACCTGAGCAACGATTTGGCTATCCGCGGCAAACG
CGGCGAATTGGCAGGCCGGGTGCGTTCGATTCAACCGGTGGCCGGTCGCGGTTACGAAGAACGTCGGGTC
GAGCTCATCGATCCCCACACCTGGCTGGTCTGGCTGGATTTTACCATTCAGGAAACCGTGCGCGGCATGG
ACGTCAAACAAGTGCATATTCGCTATCCGTTAACGGTAGTGCGTTACGACGTCGATCCCGAACTCAATCC
CTGGGGACTGGCCTTAAGCGGTTTTGCCGGCGACGGACCGACGCGTATTCAAGCCCATGAACAGACCGCA
GCTGCTGACGAGTGA
 Primer design