SecReT4
Protein ID: 333983724
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2026
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2220130..2220981 [+]
Productintegrating conjugative element protein
Component typeTfc13
UniProt IDG0A5A5
KEGG IDmmt:Metme_2026
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.1e-70, Aligned region: 22..283
Protein Sequence: 283 a.a.     [Download]
>gi|333983724|ref|YP_004512934.1| unnamed protein product [Methylomonas methanica MC09]
MPTTSQRPFIKLSLLGALLCFGIVCSQSTWADTGVERLFWDKVPLRITLPVGQERLVSFPGDVRVGIPQP
LTSKLRTQSHAGTVYWLAKEAFELQRIEVRDISGQGIVLIDLSAGQSPGLPDNPIEILFKPGQPATAEGL
LSADADSTPATSHRKSKPGKQLKSANLVALTRFAAQQLYAPARLLKASPAIRRVSVSQTPIEHLLRGESL
IATPVASWRSGKLYVTALEIKNTGPDAIDLDPRQVRGQWRAATFQHSRLHPAGSEADTSAVYLVSDRPFH
EAL
 
Nucleotide Sequence: 852 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2220130-2220981 Methylomonas methanica MC09 chromosome, complete genome
ATGCCAACGACTAGCCAACGGCCTTTCATCAAACTCAGCTTACTCGGCGCTTTGTTATGCTTTGGAATAG
TCTGCAGTCAATCGACTTGGGCCGATACCGGCGTGGAACGCTTGTTTTGGGATAAGGTGCCGCTACGCAT
CACCTTGCCGGTGGGCCAGGAACGTTTGGTGAGCTTTCCGGGCGACGTTCGGGTGGGTATTCCGCAACCC
TTGACGAGCAAATTACGCACCCAAAGCCATGCCGGTACCGTCTATTGGTTGGCCAAAGAGGCGTTTGAAC
TGCAGCGCATTGAAGTACGCGACATTTCGGGGCAGGGCATTGTATTGATCGATCTGAGTGCCGGGCAGTC
GCCGGGTTTGCCGGATAATCCGATTGAAATTCTGTTCAAGCCCGGACAACCTGCAACGGCTGAAGGCTTG
TTAAGCGCGGACGCGGATTCAACACCCGCGACCAGCCACCGAAAATCAAAACCAGGTAAACAACTGAAAT
CTGCAAATCTCGTGGCCTTGACCCGCTTTGCAGCCCAGCAGCTCTATGCTCCGGCCCGCTTGTTAAAAGC
CTCTCCCGCGATACGGCGGGTGTCGGTCAGTCAAACCCCCATCGAACATTTGCTGAGAGGGGAAAGTTTG
ATAGCGACGCCGGTGGCCAGTTGGCGTAGCGGCAAATTGTATGTCACGGCGTTGGAAATCAAAAACACCG
GCCCGGATGCGATCGATCTCGATCCTCGCCAAGTGCGCGGCCAATGGCGGGCGGCGACGTTTCAGCATAG
TCGTTTGCATCCGGCCGGCAGCGAAGCCGATACCAGTGCCGTGTATCTGGTTTCGGACCGGCCCTTTCAC
GAGGCACTTTGA
 Primer design