SecReT4
Protein ID: 333983725
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2027
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2220983..2222386 [+]
Productintegrating conjugative element protein
Component typeTfc14
UniProt IDG0A5A6
KEGG IDmmt:Metme_2027
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 467 a.a.     [Download]
>gi|333983725|ref|YP_004512935.1| unnamed protein product [Methylomonas methanica MC09]
MGANRLLPIIAGLILVMLVVVGVKTSQQMSDPVHLAAVPQAGRPDVDSPADTIRTLSAEVANIKSESEKL
QMQNEALLKQRDEIETRVKAELQSQLAQDAEQQTNEAVSQLAQQVDYFKSRLDQLSTSASQTLAASGHDI
PIGFGIGADDGLQVFGSPLTWIEPLGTQRDDKGQPIFNSVANGAERLLHDGQQAADTSEAYLTESASALT
EADRPLYTVPRNATLIGATGMTALIGRIPIKGTIEDPFPFKVIVGRDNLAANGIEMPGLDGIVFSGKAAG
DWTLSCVRGEVLSATYVFADGTIRTLSSDDNSLSREKQSSGAGTNNASRTLGWISDRRGIPCVTGTRISN
AASYLSGRILASAAEAAAGAFSQSQVTNSVSAAQGVATSVITGDAAQYAGGKALAGGATELGEYLRERTA
QSFDVVYVDTGAELAIHIDVALAIDYEPGGRKTQYDLAENEVDDELD
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2220983-2222386 Methylomonas methanica MC09 chromosome, complete genome
ATGGGCGCGAACCGGCTATTACCCATCATTGCAGGGCTTATCTTAGTTATGCTGGTGGTGGTCGGCGTCA
AGACCAGCCAGCAAATGTCGGATCCGGTGCACTTGGCCGCGGTACCGCAAGCCGGCCGTCCGGATGTGGA
TTCACCGGCCGACACCATACGCACGCTGAGTGCCGAAGTCGCCAATATCAAGAGCGAAAGCGAAAAACTG
CAGATGCAAAATGAGGCCTTGCTCAAACAGCGTGATGAAATCGAAACCCGGGTCAAAGCCGAACTGCAAT
CGCAACTGGCCCAGGATGCCGAGCAACAGACCAACGAAGCCGTCAGCCAGCTGGCGCAGCAAGTCGATTA
TTTTAAAAGCCGGCTGGATCAACTGAGCACTTCAGCCAGTCAAACGCTGGCGGCGTCGGGTCATGATATT
CCGATCGGTTTTGGCATCGGCGCGGACGACGGTTTGCAGGTTTTCGGATCCCCCTTGACCTGGATTGAAC
CCTTGGGAACGCAACGCGATGACAAAGGCCAGCCAATTTTTAACAGCGTGGCAAACGGCGCTGAGCGTTT
ATTACACGATGGTCAACAGGCTGCAGATACCAGCGAAGCCTATCTCACAGAATCAGCCAGCGCCTTAACC
GAAGCGGATCGTCCGCTCTATACCGTGCCGCGTAATGCCACGTTAATTGGTGCCACCGGCATGACCGCCT
TGATCGGCAGAATCCCGATTAAAGGCACGATCGAAGATCCGTTTCCGTTCAAAGTGATTGTCGGCCGCGA
TAATTTGGCTGCCAACGGCATCGAAATGCCCGGCTTGGACGGGATTGTATTCAGCGGCAAAGCGGCCGGC
GACTGGACCTTATCCTGTGTGCGCGGCGAAGTCCTGTCGGCGACGTATGTCTTTGCCGACGGCACCATAC
GCACGTTGTCGTCTGACGACAATAGCTTGAGCCGGGAAAAACAATCCTCTGGCGCCGGGACTAATAATGC
ATCGCGCACCTTGGGCTGGATTTCCGATCGGCGCGGGATTCCGTGCGTAACCGGCACCCGCATCAGCAAC
GCCGCCAGCTATTTGTCGGGACGCATACTGGCCTCGGCCGCCGAAGCCGCCGCCGGCGCTTTCAGTCAAA
GCCAGGTGACCAACAGCGTTTCGGCCGCCCAGGGTGTGGCAACGTCGGTGATCACCGGCGATGCGGCACA
GTATGCCGGCGGCAAAGCCTTGGCCGGCGGTGCTACGGAACTCGGCGAGTATTTACGCGAGCGCACCGCG
CAATCGTTTGATGTGGTGTATGTGGATACCGGTGCGGAATTGGCGATTCATATCGATGTGGCATTGGCTA
TCGATTATGAACCGGGCGGCCGCAAAACCCAGTACGACTTGGCGGAAAACGAGGTGGACGATGAGCTGGA
TTAA
 Primer design